Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1012261..1013075 | Replicon | chromosome |
Accession | NZ_CP104482 | ||
Organism | Salmonella enterica strain SalSpp_sample_08_No.4 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A7U1KVS1 |
Locus tag | N4230_RS04820 | Protein ID | WP_058653211.1 |
Coordinates | 1012261..1012788 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | N4230_RS04825 | Protein ID | WP_000855694.1 |
Coordinates | 1012785..1013075 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4230_RS04790 (1007538) | 1007538..1008020 | + | 483 | Protein_939 | hypothetical protein | - |
N4230_RS04800 (1009618) | 1009618..1010286 | + | 669 | WP_000445914.1 | hypothetical protein | - |
N4230_RS04805 (1010313) | 1010313..1010807 | + | 495 | WP_020899151.1 | hypothetical protein | - |
N4230_RS04810 (1010979) | 1010979..1011635 | - | 657 | WP_093984237.1 | protein-serine/threonine phosphatase | - |
N4230_RS04815 (1011973) | 1011973..1012188 | + | 216 | Protein_944 | IS5/IS1182 family transposase | - |
N4230_RS04820 (1012261) | 1012261..1012788 | - | 528 | WP_058653211.1 | GNAT family N-acetyltransferase | Toxin |
N4230_RS04825 (1012785) | 1012785..1013075 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
N4230_RS04830 (1013345) | 1013345..1013523 | - | 179 | Protein_947 | IS3 family transposase | - |
N4230_RS04835 (1013764) | 1013764..1014090 | + | 327 | WP_000393302.1 | hypothetical protein | - |
N4230_RS04840 (1014363) | 1014363..1014710 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
N4230_RS04845 (1014695) | 1014695..1015144 | - | 450 | WP_000381617.1 | hypothetical protein | - |
N4230_RS04850 (1015576) | 1015576..1016019 | - | 444 | WP_080110658.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
N4230_RS04855 (1016476) | 1016476..1017126 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | invH | 1000177..1016019 | 15842 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T258061 WP_058653211.1 NZ_CP104482:c1012788-1012261 [Salmonella enterica]
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KVS1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |