Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 851930..852555 | Replicon | chromosome |
Accession | NZ_CP104482 | ||
Organism | Salmonella enterica strain SalSpp_sample_08_No.4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A5I5T1K0 |
Locus tag | N4230_RS04105 | Protein ID | WP_001748684.1 |
Coordinates | 852157..852555 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | N4230_RS04100 | Protein ID | WP_000557545.1 |
Coordinates | 851930..852157 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4230_RS04070 (846943) | 846943..848460 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
N4230_RS04075 (848536) | 848536..849081 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
N4230_RS04080 (849346) | 849346..850104 | + | 759 | WP_000244325.1 | amidase activator ActS | - |
N4230_RS04090 (850389) | 850389..851195 | - | 807 | WP_077907190.1 | DUF1460 domain-containing protein | - |
N4230_RS04095 (851470) | 851470..851721 | - | 252 | WP_001748683.1 | hypothetical protein | - |
N4230_RS04100 (851930) | 851930..852157 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4230_RS04105 (852157) | 852157..852555 | + | 399 | WP_001748684.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N4230_RS04110 (853361) | 853361..853897 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
N4230_RS04115 (853944) | 853944..854576 | + | 633 | WP_000835265.1 | YfdX family protein | - |
N4230_RS04120 (855295) | 855295..855882 | + | 588 | WP_001244643.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 850389..861713 | 11324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14995.39 Da Isoelectric Point: 7.7780
>T258060 WP_001748684.1 NZ_CP104482:852157-852555 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHVKERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHVKERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T1K0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MGW6 |