Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 841011..841671 | Replicon | chromosome |
| Accession | NZ_CP104482 | ||
| Organism | Salmonella enterica strain SalSpp_sample_08_No.4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5I5GR00 |
| Locus tag | N4230_RS04040 | Protein ID | WP_000244761.1 |
| Coordinates | 841258..841671 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | N4230_RS04035 | Protein ID | WP_000351186.1 |
| Coordinates | 841011..841277 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4230_RS04015 (836940) | 836940..838373 | - | 1434 | WP_080192298.1 | 6-phospho-beta-glucosidase BglA | - |
| N4230_RS04020 (838531) | 838531..838842 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| N4230_RS04025 (839006) | 839006..839665 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| N4230_RS04030 (839781) | 839781..840761 | - | 981 | WP_023193393.1 | tRNA-modifying protein YgfZ | - |
| N4230_RS04035 (841011) | 841011..841277 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| N4230_RS04040 (841258) | 841258..841671 | + | 414 | WP_000244761.1 | protein YgfX | Toxin |
| N4230_RS04045 (841724) | 841724..842245 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| N4230_RS04050 (842358) | 842358..843254 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| N4230_RS04055 (843278) | 843278..843991 | + | 714 | WP_080192297.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N4230_RS04060 (843997) | 843997..845730 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16199.15 Da Isoelectric Point: 10.7537
>T258059 WP_000244761.1 NZ_CP104482:841258-841671 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5GR00 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |