Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4409486..4410267 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | N4G50_RS21695 | Protein ID | WP_000625911.1 |
Coordinates | 4409486..4409977 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | N4G50_RS21700 | Protein ID | WP_001110450.1 |
Coordinates | 4409974..4410267 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS21670 (4406366) | 4406366..4407196 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
N4G50_RS21675 (4407398) | 4407398..4407610 | - | 213 | WP_001293880.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
N4G50_RS21680 (4408236) | 4408236..4408379 | + | 144 | Protein_4242 | transposase | - |
N4G50_RS21685 (4408396) | 4408396..4408742 | + | 347 | Protein_4243 | Rpn family recombination-promoting nuclease/putative transposase | - |
N4G50_RS21690 (4409023) | 4409023..4409271 | - | 249 | Protein_4244 | IS481 family transposase | - |
N4G50_RS21695 (4409486) | 4409486..4409977 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
N4G50_RS21700 (4409974) | 4409974..4410267 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
N4G50_RS21705 (4410584) | 4410584..4410805 | + | 222 | WP_001595143.1 | hypothetical protein | - |
N4G50_RS21710 (4411071) | 4411071..4411946 | + | 876 | WP_017441228.1 | AraC family transcriptional regulator | - |
N4G50_RS21715 (4411943) | 4411943..4412230 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
N4G50_RS21720 (4412223) | 4412223..4412405 | - | 183 | WP_023252989.1 | ATP-binding cassette domain-containing protein | - |
N4G50_RS21725 (4412425) | 4412425..4412524 | + | 100 | Protein_4251 | hypothetical protein | - |
N4G50_RS21730 (4412635) | 4412635..4412766 | + | 132 | Protein_4252 | hypothetical protein | - |
N4G50_RS21735 (4413061) | 4413061..4413966 | - | 906 | WP_038806641.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4398895..4412405 | 13510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T258055 WP_000625911.1 NZ_CP104479:c4409977-4409486 [Salmonella enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |