Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4272149..4272665 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | N4G50_RS20975 | Protein ID | WP_000220578.1 |
Coordinates | 4272149..4272433 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N4G50_RS20980 | Protein ID | WP_000212724.1 |
Coordinates | 4272423..4272665 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS20960 (4267265) | 4267265..4268917 | + | 1653 | WP_024156574.1 | alpha,alpha-phosphotrehalase | - |
N4G50_RS20965 (4269326) | 4269326..4271464 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4G50_RS20970 (4271681) | 4271681..4272145 | + | 465 | WP_024156575.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4G50_RS20975 (4272149) | 4272149..4272433 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4G50_RS20980 (4272423) | 4272423..4272665 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4G50_RS20985 (4272743) | 4272743..4274656 | - | 1914 | WP_024156576.1 | BglG family transcription antiterminator | - |
N4G50_RS20990 (4274673) | 4274673..4275413 | - | 741 | WP_000779252.1 | KDGP aldolase family protein | - |
N4G50_RS20995 (4275410) | 4275410..4276528 | - | 1119 | WP_024156577.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N4G50_RS21000 (4276512) | 4276512..4277645 | - | 1134 | WP_024156578.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T258054 WP_000220578.1 NZ_CP104479:c4272433-4272149 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |