Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4231560..4232110 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | N4G50_RS20770 | Protein ID | WP_001199743.1 |
Coordinates | 4231560..4231868 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | N4G50_RS20775 | Protein ID | WP_000016244.1 |
Coordinates | 4231871..4232110 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS20760 (4229523) | 4229523..4229810 | - | 288 | WP_024156563.1 | Arm DNA-binding domain-containing protein | - |
N4G50_RS20770 (4231560) | 4231560..4231868 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
N4G50_RS20775 (4231871) | 4231871..4232110 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
N4G50_RS20780 (4232219) | 4232219..4232443 | - | 225 | WP_031233173.1 | ribbon-helix-helix protein, CopG family | - |
N4G50_RS20790 (4233227) | 4233227..4234246 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
N4G50_RS20795 (4234274) | 4234274..4234804 | - | 531 | WP_000896758.1 | gluconokinase | - |
N4G50_RS20800 (4235021) | 4235021..4236052 | + | 1032 | WP_023181345.1 | L-idonate 5-dehydrogenase | - |
N4G50_RS20805 (4236077) | 4236077..4236841 | + | 765 | WP_000998688.1 | gluconate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4217713..4232110 | 14397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T258053 WP_001199743.1 NZ_CP104479:c4231868-4231560 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |