Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3573751..3574371 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N4G50_RS17745 | Protein ID | WP_001280991.1 |
Coordinates | 3574153..3574371 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N4G50_RS17740 | Protein ID | WP_000344807.1 |
Coordinates | 3573751..3574125 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS17730 (3568890) | 3568890..3570083 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4G50_RS17735 (3570106) | 3570106..3573255 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N4G50_RS17740 (3573751) | 3573751..3574125 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N4G50_RS17745 (3574153) | 3574153..3574371 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N4G50_RS17750 (3574550) | 3574550..3575101 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
N4G50_RS17755 (3575218) | 3575218..3575688 | + | 471 | WP_024156787.1 | YlaC family protein | - |
N4G50_RS17760 (3575743) | 3575743..3575883 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N4G50_RS17765 (3575889) | 3575889..3576149 | - | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
N4G50_RS17770 (3576374) | 3576374..3577924 | + | 1551 | WP_260944304.1 | EAL domain-containing protein | - |
N4G50_RS17780 (3578155) | 3578155..3578544 | + | 390 | WP_000961285.1 | MGMT family protein | - |
N4G50_RS17785 (3578577) | 3578577..3579146 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258050 WP_001280991.1 NZ_CP104479:3574153-3574371 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258050 WP_000344807.1 NZ_CP104479:3573751-3574125 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|