Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2462268..2462790 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | N4G50_RS12115 | Protein ID | WP_000221343.1 |
Coordinates | 2462506..2462790 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | N4G50_RS12110 | Protein ID | WP_000885424.1 |
Coordinates | 2462268..2462516 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS12090 (2458678) | 2458678..2459658 | - | 981 | WP_024156973.1 | nitronate monooxygenase | - |
N4G50_RS12095 (2459832) | 2459832..2460740 | - | 909 | WP_001176641.1 | LysR family transcriptional regulator | - |
N4G50_RS12100 (2461153) | 2461153..2461341 | + | 189 | WP_001276021.1 | DUF29 family protein | - |
N4G50_RS12105 (2461616) | 2461616..2461783 | - | 168 | Protein_2366 | DUF1493 family protein | - |
N4G50_RS12110 (2462268) | 2462268..2462516 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4G50_RS12115 (2462506) | 2462506..2462790 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4G50_RS12120 (2462961) | 2462961..2463350 | + | 390 | WP_023206403.1 | RidA family protein | - |
N4G50_RS12125 (2463402) | 2463402..2464481 | - | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
N4G50_RS12130 (2464674) | 2464674..2465162 | - | 489 | WP_024156974.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N4G50_RS12135 (2465207) | 2465207..2466715 | + | 1509 | WP_024156975.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2456960..2469572 | 12612 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T258049 WP_000221343.1 NZ_CP104479:2462506-2462790 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |