258040

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 357044..357630 Replicon chromosome
Accession NZ_CP104479
Organism Salmonella enterica strain SalSpp_sample_09_No.5

Toxin (Protein)


Gene name doc Uniprot ID A0A0R9MYB2
Locus tag N4G50_RS01655 Protein ID WP_000174966.1
Coordinates 357262..357630 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag N4G50_RS01650 Protein ID WP_001535398.1
Coordinates 357044..357265 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4G50_RS01625 (352064) 352064..353173 + 1110 WP_000822983.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
N4G50_RS01630 (353233) 353233..354159 + 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N4G50_RS01635 (354156) 354156..355433 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
N4G50_RS01640 (355430) 355430..356197 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N4G50_RS01645 (356199) 356199..356912 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N4G50_RS01650 (357044) 357044..357265 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4G50_RS01655 (357262) 357262..357630 + 369 WP_000174966.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4G50_RS01660 (357888) 357888..359204 + 1317 WP_000624749.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N4G50_RS01665 (359309) 359309..360196 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N4G50_RS01670 (360193) 360193..361038 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N4G50_RS01675 (361040) 361040..362110 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 354156..362847 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13629.91 Da        Isoelectric Point: 6.4657

>T258040 WP_000174966.1 NZ_CP104479:357262-357630 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT258040 WP_001535398.1 NZ_CP104479:357044-357265 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9MYB2

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References