Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 209720..210480 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | N4G50_RS01010 | Protein ID | WP_000533909.1 |
Coordinates | 209995..210480 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | Q8Z2B2 |
Locus tag | N4G50_RS01005 | Protein ID | WP_000965889.1 |
Coordinates | 209720..210007 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS00985 (205050) | 205050..205961 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
N4G50_RS00990 (205971) | 205971..208040 | + | 2070 | WP_001291738.1 | glycine--tRNA ligase subunit beta | - |
N4G50_RS00995 (208502) | 208502..208933 | + | 432 | Protein_197 | IS3 family transposase | - |
N4G50_RS01000 (209075) | 209075..209542 | + | 468 | WP_024156875.1 | GNAT family N-acetyltransferase | - |
N4G50_RS01005 (209720) | 209720..210007 | + | 288 | WP_000965889.1 | DUF1778 domain-containing protein | Antitoxin |
N4G50_RS01010 (209995) | 209995..210480 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
N4G50_RS01015 (210851) | 210851..211390 | - | 540 | WP_000047139.1 | copper-binding periplasmic metallochaperone CueP | - |
N4G50_RS01020 (211563) | 211563..211775 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
N4G50_RS01025 (212063) | 212063..212353 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
N4G50_RS01030 (212792) | 212792..213502 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
N4G50_RS01035 (213552) | 213552..214526 | - | 975 | WP_024156876.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
N4G50_RS01040 (214756) | 214756..215418 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T258039 WP_000533909.1 NZ_CP104479:209995-210480 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A752RW74 |