Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 90128..90795 | Replicon | chromosome |
Accession | NZ_CP104479 | ||
Organism | Salmonella enterica strain SalSpp_sample_09_No.5 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A745GLG6 |
Locus tag | N4G50_RS00440 | Protein ID | WP_024156847.1 |
Coordinates | 90128..90448 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | N4G50_RS00445 | Protein ID | WP_023181597.1 |
Coordinates | 90469..90795 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G50_RS00425 (87773) | 87773..88390 | - | 618 | WP_000984812.1 | helix-turn-helix transcriptional regulator | - |
N4G50_RS00430 (89147) | 89147..89257 | - | 111 | Protein_85 | IS3 family transposase | - |
N4G50_RS00435 (89638) | 89638..89965 | + | 328 | Protein_86 | transposase | - |
N4G50_RS00440 (90128) | 90128..90448 | - | 321 | WP_024156847.1 | TA system toxin CbtA family protein | Toxin |
N4G50_RS00445 (90469) | 90469..90795 | - | 327 | WP_023181597.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N4G50_RS00450 (90808) | 90808..91278 | - | 471 | WP_015703840.1 | DNA repair protein RadC | - |
N4G50_RS00455 (91347) | 91347..92168 | - | 822 | WP_023181598.1 | DUF932 domain-containing protein | - |
N4G50_RS00460 (92240) | 92240..92689 | - | 450 | WP_023181599.1 | hypothetical protein | - |
N4G50_RS00465 (92933) | 92933..93736 | - | 804 | WP_023181600.1 | hypothetical protein | - |
N4G50_RS00470 (93756) | 93756..94190 | - | 435 | WP_023181601.1 | hypothetical protein | - |
N4G50_RS00475 (94589) | 94589..95743 | - | 1155 | WP_233592746.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 89120..105610 | 16490 | |
- | flank | IS/Tn | - | - | 89120..89257 | 137 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12066.80 Da Isoelectric Point: 5.0482
>T258038 WP_024156847.1 NZ_CP104479:c90448-90128 [Salmonella enterica]
MNTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETVIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
MNTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETVIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|