Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2067460..2067989 | Replicon | chromosome |
Accession | NZ_CP104478 | ||
Organism | Staphylococcus aureus strain DSM 20231 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N1060_RS10215 | Protein ID | WP_000621175.1 |
Coordinates | 2067460..2067822 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | N1060_RS10220 | Protein ID | WP_000948331.1 |
Coordinates | 2067819..2067989 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1060_RS10195 (N1060_10195) | 2064440..2065210 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
N1060_RS10200 (N1060_10200) | 2065185..2065664 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
N1060_RS10205 (N1060_10205) | 2065666..2065992 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
N1060_RS10210 (N1060_10210) | 2066111..2067112 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
N1060_RS10215 (N1060_10215) | 2067460..2067822 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N1060_RS10220 (N1060_10220) | 2067819..2067989 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N1060_RS10225 (N1060_10225) | 2068074..2069222 | - | 1149 | WP_001281145.1 | alanine racemase | - |
N1060_RS10230 (N1060_10230) | 2069288..2069647 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
N1060_RS10235 (N1060_10235) | 2069651..2070142 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
N1060_RS10240 (N1060_10240) | 2070129..2071712 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
N1060_RS10245 (N1060_10245) | 2071705..2072184 | - | 480 | WP_001287088.1 | hypothetical protein | - |
N1060_RS10250 (N1060_10250) | 2072393..2072953 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T258033 WP_000621175.1 NZ_CP104478:c2067822-2067460 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|