Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2067462..2067991 | Replicon | chromosome |
Accession | NZ_CP104476 | ||
Organism | Staphylococcus aureus strain DSM 20231-Res2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N2W57_RS10215 | Protein ID | WP_000621175.1 |
Coordinates | 2067462..2067824 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | N2W57_RS10220 | Protein ID | WP_000948331.1 |
Coordinates | 2067821..2067991 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2W57_RS10195 (N2W57_10195) | 2064442..2065212 | - | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
N2W57_RS10200 (N2W57_10200) | 2065187..2065666 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
N2W57_RS10205 (N2W57_10205) | 2065668..2065994 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
N2W57_RS10210 (N2W57_10210) | 2066113..2067114 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
N2W57_RS10215 (N2W57_10215) | 2067462..2067824 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N2W57_RS10220 (N2W57_10220) | 2067821..2067991 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N2W57_RS10225 (N2W57_10225) | 2068076..2069224 | - | 1149 | WP_001281145.1 | alanine racemase | - |
N2W57_RS10230 (N2W57_10230) | 2069290..2069649 | - | 360 | WP_000581200.1 | holo-ACP synthase | - |
N2W57_RS10235 (N2W57_10235) | 2069653..2070144 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
N2W57_RS10240 (N2W57_10240) | 2070131..2071714 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
N2W57_RS10245 (N2W57_10245) | 2071707..2072186 | - | 480 | WP_001287088.1 | hypothetical protein | - |
N2W57_RS10250 (N2W57_10250) | 2072395..2072955 | - | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T258024 WP_000621175.1 NZ_CP104476:c2067824-2067462 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|