Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 821133..821610 Replicon chromosome
Accession NZ_CP104476
Organism Staphylococcus aureus strain DSM 20231-Res2

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag N2W57_RS03915 Protein ID WP_000052078.1
Coordinates 821133..821321 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag N2W57_RS03920 Protein ID WP_001059690.1
Coordinates 821350..821610 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2W57_RS03885 (N2W57_03885) 817174..817644 + 471 WP_000824472.1 hypothetical protein -
N2W57_RS03890 (N2W57_03890) 817985..818671 + 687 WP_001548082.1 thermonuclease family protein -
N2W57_RS03895 (N2W57_03895) 819028..819228 + 201 WP_001059082.1 cold-shock protein -
N2W57_RS03900 (N2W57_03900) 819724..819942 - 219 WP_000005886.1 hypothetical protein -
N2W57_RS03905 (N2W57_03905) 820004..820288 - 285 WP_001004395.1 hypothetical protein -
N2W57_RS03910 (N2W57_03910) 820376..820945 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
N2W57_RS03915 (N2W57_03915) 821133..821321 - 189 WP_000052078.1 hypothetical protein Toxin
N2W57_RS03920 (N2W57_03920) 821350..821610 - 261 WP_001059690.1 hypothetical protein Antitoxin
N2W57_RS03925 (N2W57_03925) 821951..822154 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
N2W57_RS03930 (N2W57_03930) 822151..822387 - 237 WP_000368687.1 hypothetical protein -
N2W57_RS03935 (N2W57_03935) 822612..823193 + 582 WP_001140693.1 histidine phosphatase family protein -
N2W57_RS03940 (N2W57_03940) 823266..823883 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
N2W57_RS03945 (N2W57_03945) 824038..824532 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
N2W57_RS03950 (N2W57_03950) 824931..825353 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
N2W57_RS03955 (N2W57_03955) 825501..826217 + 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T258020 WP_000052078.1 NZ_CP104476:c821321-821133 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT258020 WP_001059690.1 NZ_CP104476:c821610-821350 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References