Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 106707..107232 Replicon plasmid pUC4224_1
Accession NZ_CP104473
Organism Escherichia coli strain UC4224

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag N4S17_RS25190 Protein ID WP_001159871.1
Coordinates 106707..107012 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q3ZU16
Locus tag N4S17_RS25195 Protein ID WP_000813639.1
Coordinates 107014..107232 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4S17_RS25160 (101974) 101974..103244 + 1271 Protein_116 translesion error-prone DNA polymerase V subunit UmuC -
N4S17_RS25165 (103249) 103249..103641 - 393 WP_000340836.1 plasmid partitioning/stability family protein -
N4S17_RS25170 (103646) 103646..104617 - 972 WP_001103695.1 plasmid segregation protein ParM -
N4S17_RS25175 (104846) 104846..105490 + 645 WP_028985392.1 AAA family ATPase -
N4S17_RS25180 (105484) 105484..105759 + 276 WP_000239527.1 hypothetical protein -
N4S17_RS25185 (105897) 105897..106706 - 810 WP_000016958.1 site-specific integrase -
N4S17_RS25190 (106707) 106707..107012 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
N4S17_RS25195 (107014) 107014..107232 - 219 WP_000813639.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N4S17_RS25200 (107828) 107828..108088 + 261 WP_000343084.1 hypothetical protein -
N4S17_RS25205 (108085) 108085..108675 + 591 WP_198458803.1 hypothetical protein -
N4S17_RS25210 (108693) 108693..109040 - 348 WP_000142428.1 DUF6404 family protein -
N4S17_RS25215 (109294) 109294..109503 + 210 WP_225303885.1 colicin E1 immunity protein -
N4S17_RS25220 (109510) 109510..109830 - 321 WP_001365556.1 colicin-like pore-forming protein -
N4S17_RS25225 (109940) 109940..110671 - 732 WP_000850413.1 conjugal transfer complement resistance protein TraT -
N4S17_RS25230 (110948) 110948..111100 - 153 Protein_130 IS481 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC / espP 1..111840 111840


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T258019 WP_001159871.1 NZ_CP104473:c107012-106707 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8372.30 Da        Isoelectric Point: 4.5203

>AT258019 WP_000813639.1 NZ_CP104473:c107232-107014 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9DIR5

References