Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4067077..4067695 | Replicon | chromosome |
Accession | NZ_CP104472 | ||
Organism | Escherichia coli strain UC4224 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N4S17_RS19555 | Protein ID | WP_001291435.1 |
Coordinates | 4067077..4067295 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N4S17_RS19560 | Protein ID | WP_000344800.1 |
Coordinates | 4067321..4067695 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S17_RS19520 (4062367) | 4062367..4062939 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
N4S17_RS19525 (4062970) | 4062970..4063281 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N4S17_RS19535 (4063660) | 4063660..4064013 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N4S17_RS19540 (4064055) | 4064055..4065605 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N4S17_RS19545 (4065769) | 4065769..4066239 | - | 471 | WP_000136192.1 | YlaC family protein | - |
N4S17_RS19550 (4066355) | 4066355..4066906 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N4S17_RS19555 (4067077) | 4067077..4067295 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N4S17_RS19560 (4067321) | 4067321..4067695 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N4S17_RS19565 (4068241) | 4068241..4071390 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N4S17_RS19570 (4071413) | 4071413..4072606 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258009 WP_001291435.1 NZ_CP104472:c4067295-4067077 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258009 WP_000344800.1 NZ_CP104472:c4067695-4067321 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |