Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 4032780..4033617 | Replicon | chromosome |
| Accession | NZ_CP104472 | ||
| Organism | Escherichia coli strain UC4224 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | N4S17_RS19385 | Protein ID | WP_000227784.1 |
| Coordinates | 4032780..4033322 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | N4S17_RS19390 | Protein ID | WP_001297137.1 |
| Coordinates | 4033306..4033617 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4S17_RS19365 (4028319) | 4028319..4029230 | - | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
| N4S17_RS19370 (4029398) | 4029398..4029889 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| N4S17_RS19375 (4030017) | 4030017..4031381 | - | 1365 | WP_028985265.1 | MFS transporter | - |
| N4S17_RS19380 (4031789) | 4031789..4032724 | + | 936 | WP_001368479.1 | tetratricopeptide repeat protein | - |
| N4S17_RS19385 (4032780) | 4032780..4033322 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| N4S17_RS19390 (4033306) | 4033306..4033617 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| N4S17_RS19395 (4033802) | 4033802..4034692 | - | 891 | WP_000971336.1 | heme o synthase | - |
| N4S17_RS19400 (4034704) | 4034704..4035033 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| N4S17_RS19405 (4035033) | 4035033..4035647 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| N4S17_RS19410 (4035637) | 4035637..4037628 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| N4S17_RS19415 (4037650) | 4037650..4038597 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T258008 WP_000227784.1 NZ_CP104472:c4033322-4032780 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|