Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1322781..1323406 | Replicon | chromosome |
Accession | NZ_CP104472 | ||
Organism | Escherichia coli strain UC4224 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | N4S17_RS06445 | Protein ID | WP_000911329.1 |
Coordinates | 1322781..1323179 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N4S17_RS06450 | Protein ID | WP_000450524.1 |
Coordinates | 1323179..1323406 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S17_RS06425 (1318659) | 1318659..1318859 | + | 201 | WP_000383836.1 | YpfN family protein | - |
N4S17_RS06430 (1318969) | 1318969..1319667 | - | 699 | WP_000679812.1 | esterase | - |
N4S17_RS06435 (1319741) | 1319741..1321756 | - | 2016 | WP_028985187.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N4S17_RS06440 (1321771) | 1321771..1322634 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
N4S17_RS06445 (1322781) | 1322781..1323179 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4S17_RS06450 (1323179) | 1323179..1323406 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N4S17_RS06455 (1323561) | 1323561..1324274 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N4S17_RS06460 (1324487) | 1324487..1325521 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
N4S17_RS06465 (1325538) | 1325538..1326416 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N4S17_RS06470 (1326562) | 1326562..1327134 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N4S17_RS06475 (1327134) | 1327134..1327604 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T257995 WP_000911329.1 NZ_CP104472:c1323179-1322781 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |