Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 186880..187518 | Replicon | chromosome |
Accession | NZ_CP104472 | ||
Organism | Escherichia coli strain UC4224 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N4S17_RS00900 | Protein ID | WP_000813794.1 |
Coordinates | 186880..187056 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4S17_RS00905 | Protein ID | WP_001270286.1 |
Coordinates | 187102..187518 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S17_RS00880 (182499) | 182499..183674 | - | 1176 | WP_001236296.1 | BenE family transporter YdcO | - |
N4S17_RS00885 (183766) | 183766..184302 | + | 537 | WP_000429152.1 | DNA-binding transcriptional regulator SutR | - |
N4S17_RS00890 (184375) | 184375..186336 | + | 1962 | WP_001442195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N4S17_RS00895 (186428) | 186428..186658 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N4S17_RS00900 (186880) | 186880..187056 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N4S17_RS00905 (187102) | 187102..187518 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N4S17_RS00910 (187597) | 187597..189003 | + | 1407 | WP_000760615.1 | PLP-dependent aminotransferase family protein | - |
N4S17_RS00915 (189248) | 189248..190393 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
N4S17_RS00920 (190411) | 190411..191424 | + | 1014 | WP_001583503.1 | ABC transporter ATP-binding protein | - |
N4S17_RS00925 (191425) | 191425..192366 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257987 WP_000813794.1 NZ_CP104472:186880-187056 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257987 WP_001270286.1 NZ_CP104472:187102-187518 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|