Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4561716..4562332 | Replicon | chromosome |
| Accession | NZ_CP104471 | ||
| Organism | Enterobacter hormaechei strain 80014967 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NYP10_RS23030 | Protein ID | WP_080336832.1 |
| Coordinates | 4561716..4562087 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | NYP10_RS23035 | Protein ID | WP_015569912.1 |
| Coordinates | 4562090..4562332 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP10_RS23015 (NYP10_23025) | 4559216..4560118 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
| NYP10_RS23020 (NYP10_23030) | 4560115..4560750 | + | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NYP10_RS23025 (NYP10_23035) | 4560747..4561676 | + | 930 | WP_023323896.1 | formate dehydrogenase accessory protein FdhE | - |
| NYP10_RS23030 (NYP10_23040) | 4561716..4562087 | - | 372 | WP_080336832.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NYP10_RS23035 (NYP10_23045) | 4562090..4562332 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NYP10_RS23040 (NYP10_23050) | 4562531..4563451 | + | 921 | WP_045343465.1 | alpha/beta hydrolase | - |
| NYP10_RS23045 (NYP10_23055) | 4563460..4564401 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| NYP10_RS23050 (NYP10_23060) | 4564446..4564883 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| NYP10_RS23055 (NYP10_23065) | 4564880..4565761 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| NYP10_RS23060 (NYP10_23070) | 4565755..4566354 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| NYP10_RS23065 (NYP10_23075) | 4566473..4567273 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T257986 WP_080336832.1 NZ_CP104471:c4562087-4561716 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQL
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|