Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3756771..3757428 | Replicon | chromosome |
Accession | NZ_CP104471 | ||
Organism | Enterobacter hormaechei strain 80014967 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A0A6GSQ9 |
Locus tag | NYP10_RS19185 | Protein ID | WP_022649305.1 |
Coordinates | 3756771..3757181 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | NYP10_RS19190 | Protein ID | WP_003863437.1 |
Coordinates | 3757162..3757428 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP10_RS19165 (NYP10_19175) | 3752769..3754502 | - | 1734 | WP_047054429.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NYP10_RS19170 (NYP10_19180) | 3754508..3755221 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NYP10_RS19175 (NYP10_19185) | 3755250..3756146 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
NYP10_RS19180 (NYP10_19190) | 3756248..3756769 | + | 522 | WP_003863440.1 | flavodoxin FldB | - |
NYP10_RS19185 (NYP10_19195) | 3756771..3757181 | - | 411 | WP_022649305.1 | protein YgfX | Toxin |
NYP10_RS19190 (NYP10_19200) | 3757162..3757428 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
NYP10_RS19195 (NYP10_19205) | 3757723..3758703 | + | 981 | WP_047054431.1 | tRNA-modifying protein YgfZ | - |
NYP10_RS19200 (NYP10_19210) | 3758769..3759860 | - | 1092 | WP_227661289.1 | IS4 family transposase | - |
NYP10_RS19205 (NYP10_19215) | 3760077..3760736 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
NYP10_RS19210 (NYP10_19220) | 3761003..3761734 | + | 732 | WP_023314798.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T257985 WP_022649305.1 NZ_CP104471:c3757181-3756771 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A6GSQ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |