Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2306291..2307030 | Replicon | chromosome |
Accession | NZ_CP104471 | ||
Organism | Enterobacter hormaechei strain 80014967 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | NYP10_RS12350 | Protein ID | WP_047055520.1 |
Coordinates | 2306291..2306776 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A927HKN6 |
Locus tag | NYP10_RS12355 | Protein ID | WP_045336276.1 |
Coordinates | 2306764..2307030 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP10_RS12330 (NYP10_12340) | 2302445..2303203 | - | 759 | WP_047055523.1 | trans-aconitate 2-methyltransferase | - |
NYP10_RS12335 (NYP10_12345) | 2303288..2303872 | - | 585 | WP_001190898.1 | GDP-mannose pyrophosphatase nudK | - |
NYP10_RS12340 (NYP10_12350) | 2303959..2304717 | + | 759 | WP_003857136.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NYP10_RS12345 (NYP10_12355) | 2304822..2306114 | + | 1293 | WP_047055521.1 | glycosyl hydrolase family 28 protein | - |
NYP10_RS12350 (NYP10_12360) | 2306291..2306776 | - | 486 | WP_047055520.1 | GNAT family N-acetyltransferase | Toxin |
NYP10_RS12355 (NYP10_12365) | 2306764..2307030 | - | 267 | WP_045336276.1 | DUF1778 domain-containing protein | Antitoxin |
NYP10_RS12360 (NYP10_12370) | 2307094..2308023 | - | 930 | WP_045894389.1 | LysR family transcriptional regulator | - |
NYP10_RS12365 (NYP10_12375) | 2308153..2309541 | + | 1389 | WP_047055517.1 | MFS transporter | - |
NYP10_RS12370 (NYP10_12380) | 2309563..2310558 | - | 996 | WP_261300456.1 | DUF2891 domain-containing protein | - |
NYP10_RS12375 (NYP10_12385) | 2310568..2311554 | - | 987 | WP_047055515.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T257979 WP_047055520.1 NZ_CP104471:c2306776-2306291 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLGEFVSGEAVLDEWLKQRGLKNQALGAARTFVICKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLGEFVSGEAVLDEWLKQRGLKNQALGAARTFVICKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|