257978

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 1808577..1809220 Replicon chromosome
Accession NZ_CP104471
Organism Enterobacter hormaechei strain 80014967

Toxin (Protein)


Gene name vagD Uniprot ID A0A155IU92
Locus tag NYP10_RS09850 Protein ID WP_000754567.1
Coordinates 1808804..1809220 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A155IUD1
Locus tag NYP10_RS09845 Protein ID WP_023293777.1
Coordinates 1808577..1808807 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP10_RS09815 (NYP10_09820) 1803633..1804064 + 432 WP_006796638.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
NYP10_RS09820 (NYP10_09825) 1804064..1805335 + 1272 WP_032627083.1 Y-family DNA polymerase -
NYP10_RS09825 (NYP10_09830) 1805417..1806391 - 975 WP_000064119.1 ParB family protein -
NYP10_RS09830 (NYP10_09835) 1806391..1807596 - 1206 WP_006797591.1 AAA family ATPase -
NYP10_RS09835 (NYP10_09840) 1807726..1807797 + 72 Protein_1687 hypothetical protein -
NYP10_RS09840 (NYP10_09845) 1807885..1808439 - 555 WP_161646454.1 hypothetical protein -
NYP10_RS09845 (NYP10_09850) 1808577..1808807 + 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NYP10_RS09850 (NYP10_09855) 1808804..1809220 + 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin Toxin
NYP10_RS09855 (NYP10_09860) 1809571..1810539 - 969 WP_084832609.1 IS5-like element IS903B family transposase -
NYP10_RS09860 (NYP10_09865) 1810665..1811366 - 702 WP_008502228.1 DsbA family oxidoreductase -
NYP10_RS09865 (NYP10_09870) 1811432..1812538 - 1107 WP_006687059.1 alkene reductase -
NYP10_RS09870 (NYP10_09875) 1812751..1813080 + 330 WP_008502229.1 thioredoxin family protein -
NYP10_RS09875 (NYP10_09880) 1813110..1813448 - 339 WP_000888080.1 carboxymuconolactone decarboxylase family protein -
NYP10_RS09880 (NYP10_09885) 1813453..1814034 - 582 WP_032676110.1 TetR/AcrR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage mcr-10 - 1772527..1834142 61615


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15108.61 Da        Isoelectric Point: 8.5403

>T257978 WP_000754567.1 NZ_CP104471:1808804-1809220 [Enterobacter hormaechei]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.73 Da        Isoelectric Point: 4.4299

>AT257978 WP_023293777.1 NZ_CP104471:1808577-1808807 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAQREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A155IU92

Antitoxin

Source ID Structure
AlphaFold DB A0A155IUD1

References