Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 939523..940238 | Replicon | chromosome |
Accession | NZ_CP104471 | ||
Organism | Enterobacter hormaechei strain 80014967 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A8I0UM05 |
Locus tag | NYP10_RS05650 | Protein ID | WP_023303149.1 |
Coordinates | 939870..940238 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NYP10_RS05645 | Protein ID | WP_180242253.1 |
Coordinates | 939523..939849 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP10_RS05620 (NYP10_05620) | 934557..935822 | + | 1266 | WP_023303143.1 | hypothetical protein | - |
NYP10_RS05625 (NYP10_05625) | 936131..936565 | + | 435 | WP_023303144.1 | hypothetical protein | - |
NYP10_RS05630 (NYP10_05630) | 936624..937463 | + | 840 | WP_023303145.1 | hypothetical protein | - |
NYP10_RS05635 (NYP10_05640) | 938153..938974 | + | 822 | WP_023303146.1 | DUF932 domain-containing protein | - |
NYP10_RS05640 (NYP10_05645) | 939040..939510 | + | 471 | WP_023303147.1 | DNA repair protein RadC | - |
NYP10_RS05645 (NYP10_05650) | 939523..939849 | + | 327 | WP_180242253.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NYP10_RS05650 (NYP10_05655) | 939870..940238 | + | 369 | WP_023303149.1 | TA system toxin CbtA family protein | Toxin |
NYP10_RS05655 (NYP10_05660) | 941004..941162 | + | 159 | WP_023315491.1 | hypothetical protein | - |
NYP10_RS05660 (NYP10_05665) | 941268..941810 | + | 543 | WP_032608608.1 | type IV secretion protein Rhs | - |
NYP10_RS05665 (NYP10_05670) | 941813..942169 | + | 357 | WP_032608610.1 | hypothetical protein | - |
NYP10_RS05670 (NYP10_05675) | 942192..942383 | - | 192 | WP_071785715.1 | YecR family lipoprotein | - |
NYP10_RS05675 (NYP10_05680) | 942376..943574 | + | 1199 | WP_136780082.1 | IS3 family transposase | - |
NYP10_RS05680 (NYP10_05685) | 943681..944427 | - | 747 | WP_045344151.1 | class I SAM-dependent methyltransferase | - |
NYP10_RS05685 (NYP10_05690) | 944438..944695 | - | 258 | WP_003863178.1 | YjhX family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 918605..943574 | 24969 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13727.91 Da Isoelectric Point: 8.2822
>T257975 WP_023303149.1 NZ_CP104471:939870-940238 [Enterobacter hormaechei]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|