Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeV-yafW/CbtA-CbeA |
Location | 403290..404083 | Replicon | chromosome |
Accession | NZ_CP104471 | ||
Organism | Enterobacter hormaechei strain 80014967 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1EZ92 |
Locus tag | NYP10_RS03065 | Protein ID | WP_000854726.1 |
Coordinates | 403290..403667 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | S1EBQ7 |
Locus tag | NYP10_RS03070 | Protein ID | WP_001548930.1 |
Coordinates | 403757..404083 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP10_RS03045 (NYP10_03045) | 400802..401422 | - | 621 | WP_032608268.1 | DUF2238 domain-containing protein | - |
NYP10_RS03050 (NYP10_03050) | 401669..402511 | - | 843 | WP_001548928.1 | DUF4942 domain-containing protein | - |
NYP10_RS03055 (NYP10_03055) | 402596..402793 | - | 198 | WP_000839269.1 | DUF957 domain-containing protein | - |
NYP10_RS03060 (NYP10_03060) | 402805..403293 | - | 489 | WP_001547769.1 | DUF5983 family protein | - |
NYP10_RS03065 (NYP10_03065) | 403290..403667 | - | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
NYP10_RS03070 (NYP10_03070) | 403757..404083 | - | 327 | WP_001548930.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
NYP10_RS03075 (NYP10_03075) | 404102..404323 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
NYP10_RS03080 (NYP10_03080) | 404332..404808 | - | 477 | WP_000811693.1 | RadC family protein | - |
NYP10_RS03085 (NYP10_03085) | 404824..405282 | - | 459 | WP_000211838.1 | antirestriction protein | - |
NYP10_RS03090 (NYP10_03090) | 405380..405619 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
NYP10_RS03095 (NYP10_03095) | 405696..406163 | - | 468 | WP_045351203.1 | protein YkfB | - |
NYP10_RS03100 (NYP10_03100) | 406187..406630 | - | 444 | WP_045351202.1 | lipoprotein YafY | - |
NYP10_RS03105 (NYP10_03105) | 406630..406866 | - | 237 | WP_001115854.1 | protein YpjK | - |
NYP10_RS03110 (NYP10_03110) | 406903..407604 | - | 702 | WP_001548933.1 | WYL domain-containing protein | - |
NYP10_RS03115 (NYP10_03115) | 407822..408430 | - | 609 | Protein_377 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | wza | 402805..427925 | 25120 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T257974 WP_000854726.1 NZ_CP104471:c403667-403290 [Enterobacter hormaechei]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|