Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 304207..304803 | Replicon | chromosome |
Accession | NZ_CP104471 | ||
Organism | Enterobacter hormaechei strain 80014967 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NYP10_RS02595 | Protein ID | WP_023295756.1 |
Coordinates | 304501..304803 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A927HL08 |
Locus tag | NYP10_RS02590 | Protein ID | WP_023295755.1 |
Coordinates | 304207..304494 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP10_RS02585 (NYP10_02585) | 302579..304210 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
NYP10_RS02590 (NYP10_02590) | 304207..304494 | - | 288 | WP_023295755.1 | putative addiction module antidote protein | Antitoxin |
NYP10_RS02595 (NYP10_02595) | 304501..304803 | - | 303 | WP_023295756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYP10_RS02600 (NYP10_02600) | 305001..305873 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
NYP10_RS02605 (NYP10_02605) | 305874..306146 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
NYP10_RS02610 (NYP10_02610) | 306197..307141 | - | 945 | WP_015570166.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
NYP10_RS02615 (NYP10_02615) | 307235..308584 | - | 1350 | WP_006810501.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11441.24 Da Isoelectric Point: 10.1042
>T257973 WP_023295756.1 NZ_CP104471:c304803-304501 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|