Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
| Location | 6598085..6598690 | Replicon | chromosome |
| Accession | NZ_CP104467 | ||
| Organism | Paenibacillus sp. SS4 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A1V4HIK6 |
| Locus tag | NYR53_RS29515 | Protein ID | WP_028553893.1 |
| Coordinates | 6598085..6598435 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NYR53_RS29520 | Protein ID | WP_157318061.1 |
| Coordinates | 6598439..6598690 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR53_RS29495 | 6593140..6593493 | + | 354 | WP_261302611.1 | hydrolase/acyltransferase | - |
| NYR53_RS29500 | 6593664..6593828 | + | 165 | WP_090818813.1 | cortex morphogenetic protein CmpA | - |
| NYR53_RS29505 | 6594263..6594979 | + | 717 | WP_261302612.1 | hypothetical protein | - |
| NYR53_RS29510 | 6595676..6597919 | - | 2244 | WP_261306569.1 | Tex family protein | - |
| NYR53_RS29515 | 6598085..6598435 | - | 351 | WP_028553893.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NYR53_RS29520 | 6598439..6598690 | - | 252 | WP_157318061.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| NYR53_RS29525 | 6598946..6600136 | - | 1191 | WP_261302613.1 | alanine racemase | - |
| NYR53_RS29530 | 6600219..6601559 | - | 1341 | WP_261302614.1 | SEC-C metal-binding domain-containing protein | - |
| NYR53_RS29535 | 6601731..6602912 | - | 1182 | WP_261302615.1 | outer membrane lipoprotein-sorting protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12860.75 Da Isoelectric Point: 4.8837
>T257970 WP_028553893.1 NZ_CP104467:c6598435-6598085 [Paenibacillus sp. SS4]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAETHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRKVDDALQISVGLIEF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAETHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMRKVDDALQISVGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|