Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 19373..19899 | Replicon | plasmid pIncFII_Silv108 |
Accession | NZ_CP104453 | ||
Organism | Raoultella ornithinolytica strain MQB_Silv_108 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | N2J37_RS29655 | Protein ID | WP_000323025.1 |
Coordinates | 19612..19899 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | N2J37_RS29650 | Protein ID | WP_000534858.1 |
Coordinates | 19373..19612 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2J37_RS29630 (N2J37_29630) | 15701..16939 | + | 1239 | WP_003030308.1 | IS110 family transposase | - |
N2J37_RS29635 (N2J37_29635) | 17415..17987 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
N2J37_RS29640 (N2J37_29640) | 18187..19110 | + | 924 | WP_020277922.1 | cation diffusion facilitator family transporter | - |
N2J37_RS29645 (N2J37_29645) | 19244..19348 | - | 105 | Protein_21 | hypothetical protein | - |
N2J37_RS29650 (N2J37_29650) | 19373..19612 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
N2J37_RS29655 (N2J37_29655) | 19612..19899 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
N2J37_RS29660 (N2J37_29660) | 19954..20988 | - | 1035 | Protein_24 | IS481 family transposase | - |
N2J37_RS29665 (N2J37_29665) | 21049..21141 | + | 93 | Protein_25 | Hok/Gef family protein | - |
N2J37_RS29670 (N2J37_29670) | 21105..21206 | + | 102 | Protein_26 | FlmC family protein | - |
N2J37_RS29675 (N2J37_29675) | 21371..21856 | - | 486 | WP_020277937.1 | hypothetical protein | - |
N2J37_RS29680 (N2J37_29680) | 22046..22318 | + | 273 | WP_023280873.1 | hypothetical protein | - |
N2J37_RS29685 (N2J37_29685) | 22315..22665 | + | 351 | WP_020277938.1 | hypothetical protein | - |
N2J37_RS29690 (N2J37_29690) | 23182..23562 | + | 381 | WP_015632488.1 | hypothetical protein | - |
N2J37_RS29695 (N2J37_29695) | 23628..23975 | + | 348 | WP_020316654.1 | hypothetical protein | - |
N2J37_RS29700 (N2J37_29700) | 24063..24293 | + | 231 | WP_020805755.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..128787 | 128787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T257969 WP_000323025.1 NZ_CP104453:19612-19899 [Raoultella ornithinolytica]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|