Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5811..6336 Replicon plasmid pIncFII_Silv108
Accession NZ_CP104453
Organism Raoultella ornithinolytica strain MQB_Silv_108

Toxin (Protein)


Gene name ccdB Uniprot ID W8UQV6
Locus tag N2J37_RS29575 Protein ID WP_001568026.1
Coordinates 5811..6116 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag N2J37_RS29580 Protein ID WP_001568025.1
Coordinates 6118..6336 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2J37_RS29545 (N2J37_29545) 1511..2137 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
N2J37_RS29550 (N2J37_29550) 2134..2436 + 303 WP_004197636.1 hypothetical protein -
N2J37_RS29555 (N2J37_29555) 2892..3686 - 795 WP_004197635.1 site-specific integrase -
N2J37_RS29560 (N2J37_29560) 3884..4900 - 1017 WP_020315256.1 hypothetical protein -
N2J37_RS29565 (N2J37_29565) 4897..5220 - 324 WP_022644730.1 hypothetical protein -
N2J37_RS29570 (N2J37_29570) 5247..5642 - 396 WP_017899885.1 hypothetical protein -
N2J37_RS29575 (N2J37_29575) 5811..6116 - 306 WP_001568026.1 type II toxin-antitoxin system toxin CcdB Toxin
N2J37_RS29580 (N2J37_29580) 6118..6336 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N2J37_RS29585 (N2J37_29585) 6932..7180 + 249 WP_032415726.1 hypothetical protein -
N2J37_RS29590 (N2J37_29590) 7177..8409 + 1233 WP_004200905.1 hypothetical protein -
N2J37_RS29595 (N2J37_29595) 8543..9034 + 492 WP_004200903.1 hypothetical protein -
N2J37_RS29600 (N2J37_29600) 10037..10159 - 123 WP_254913144.1 hypothetical protein -
N2J37_RS29605 (N2J37_29605) 10259..10567 - 309 WP_017896554.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..128787 128787


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11645.32 Da        Isoelectric Point: 5.6919

>T257968 WP_001568026.1 NZ_CP104453:c6116-5811 [Raoultella ornithinolytica]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT257968 WP_001568025.1 NZ_CP104453:c6336-6118 [Raoultella ornithinolytica]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A514EZN1

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References