Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 96941..97680 | Replicon | plasmid pIncFIB_Silv108 |
| Accession | NZ_CP104452 | ||
| Organism | Raoultella ornithinolytica strain MQB_Silv_108 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | N2J37_RS29290 | Protein ID | WP_076752153.1 |
| Coordinates | 97195..97680 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A5E1AWX8 |
| Locus tag | N2J37_RS29285 | Protein ID | WP_012540086.1 |
| Coordinates | 96941..97207 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2J37_RS29255 (N2J37_29255) | 92171..92707 | - | 537 | WP_013087166.1 | GNAT family N-acetyltransferase | - |
| N2J37_RS29260 (N2J37_29260) | 92832..94583 | - | 1752 | WP_175406650.1 | arsenical pump-driving ATPase | - |
| N2J37_RS29265 (N2J37_29265) | 94610..94972 | - | 363 | WP_013087168.1 | arsenic metallochaperone ArsD family protein | - |
| N2J37_RS29270 (N2J37_29270) | 95048..95593 | - | 546 | WP_047365773.1 | sigma-70 family RNA polymerase sigma factor | - |
| N2J37_RS29275 (N2J37_29275) | 95602..96315 | - | 714 | WP_013087170.1 | arsenical resistance protein ArsH | - |
| N2J37_RS29280 (N2J37_29280) | 96317..96640 | - | 324 | WP_013087171.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| N2J37_RS29285 (N2J37_29285) | 96941..97207 | + | 267 | WP_012540086.1 | DUF1778 domain-containing protein | Antitoxin |
| N2J37_RS29290 (N2J37_29290) | 97195..97680 | + | 486 | WP_076752153.1 | GNAT family N-acetyltransferase | Toxin |
| N2J37_RS29295 (N2J37_29295) | 97964..98116 | + | 153 | WP_223526259.1 | DUF5431 family protein | - |
| N2J37_RS29300 (N2J37_29300) | 98064..98180 | + | 117 | WP_223176086.1 | type I toxin-antitoxin system Hok family toxin | - |
| N2J37_RS29305 (N2J37_29305) | 99085..99357 | + | 273 | WP_137055850.1 | hypothetical protein | - |
| N2J37_RS29310 (N2J37_29310) | 99460..99807 | + | 348 | WP_076752140.1 | hypothetical protein | - |
| N2J37_RS29315 (N2J37_29315) | 99896..100126 | + | 231 | WP_076752138.1 | hypothetical protein | - |
| N2J37_RS29320 (N2J37_29320) | 100173..101006 | + | 834 | WP_076752137.1 | N-6 DNA methylase | - |
| N2J37_RS29325 (N2J37_29325) | 101210..101440 | - | 231 | WP_076752135.1 | hypothetical protein | - |
| N2J37_RS29330 (N2J37_29330) | 101632..102162 | + | 531 | WP_076752134.1 | antirestriction protein | - |
| N2J37_RS29335 (N2J37_29335) | 102200..102676 | - | 477 | WP_076752132.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..138718 | 138718 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17838.68 Da Isoelectric Point: 10.0748
>T257967 WP_076752153.1 NZ_CP104452:97195-97680 [Raoultella ornithinolytica]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSRTQQRTLFLKLP
Q
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSRTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|