Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 5033130..5033709 | Replicon | chromosome |
Accession | NZ_CP104450 | ||
Organism | Raoultella ornithinolytica strain MQB_Silv_108 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | N2J37_RS24475 | Protein ID | WP_260990351.1 |
Coordinates | 5033422..5033709 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | N2J37_RS24470 | Protein ID | WP_160873248.1 |
Coordinates | 5033130..5033435 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2J37_RS24445 (N2J37_24445) | 5028337..5029401 | - | 1065 | WP_004857527.1 | DUF2955 domain-containing protein | - |
N2J37_RS24450 (N2J37_24450) | 5029391..5030458 | - | 1068 | WP_004857525.1 | HlyD family secretion protein | - |
N2J37_RS24455 (N2J37_24455) | 5030465..5030929 | - | 465 | WP_004857523.1 | MarR family transcriptional regulator | - |
N2J37_RS24460 (N2J37_24460) | 5031220..5031384 | - | 165 | WP_004857521.1 | DUF1127 domain-containing protein | - |
N2J37_RS24465 (N2J37_24465) | 5031562..5032974 | + | 1413 | WP_015585221.1 | PLP-dependent aminotransferase family protein | - |
N2J37_RS24470 (N2J37_24470) | 5033130..5033435 | - | 306 | WP_160873248.1 | BrnA antitoxin family protein | Antitoxin |
N2J37_RS24475 (N2J37_24475) | 5033422..5033709 | - | 288 | WP_260990351.1 | BrnT family toxin | Toxin |
N2J37_RS24480 (N2J37_24480) | 5033826..5034245 | - | 420 | WP_260990352.1 | FosA family fosfomycin resistance glutathione transferase | - |
N2J37_RS24485 (N2J37_24485) | 5034249..5035129 | - | 881 | Protein_4808 | LysR family transcriptional regulator | - |
N2J37_RS24490 (N2J37_24490) | 5035217..5035987 | + | 771 | WP_152292992.1 | NAD(P)H-dependent oxidoreductase | - |
N2J37_RS24495 (N2J37_24495) | 5036135..5036713 | + | 579 | WP_113991322.1 | TetR/AcrR family transcriptional regulator | - |
N2J37_RS24500 (N2J37_24500) | 5036857..5037669 | + | 813 | WP_004857492.1 | winged helix-turn-helix domain-containing protein | - |
N2J37_RS24505 (N2J37_24505) | 5037666..5038184 | + | 519 | WP_015585229.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11037.46 Da Isoelectric Point: 7.0747
>T257965 WP_260990351.1 NZ_CP104450:c5033709-5033422 [Raoultella ornithinolytica]
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRQDRYENGEHRWQTIGLVHGIIVILVVHSVRFESGAEVIRIIS
ARKADGKERSRYEHG
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRQDRYENGEHRWQTIGLVHGIIVILVVHSVRFESGAEVIRIIS
ARKADGKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|