Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 2571203..2572116 | Replicon | chromosome |
Accession | NZ_CP104450 | ||
Organism | Raoultella ornithinolytica strain MQB_Silv_108 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A808Y4A8 |
Locus tag | N2J37_RS12365 | Protein ID | WP_015584188.1 |
Coordinates | 2571203..2571676 (-) | Length | 158 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A808Y7A4 |
Locus tag | N2J37_RS12370 | Protein ID | WP_004862777.1 |
Coordinates | 2571673..2572116 (-) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2J37_RS12340 (N2J37_12340) | 2567242..2567850 | - | 609 | WP_044349854.1 | glutathione S-transferase family protein | - |
N2J37_RS12345 (N2J37_12345) | 2568092..2568997 | + | 906 | WP_128319035.1 | LysR substrate-binding domain-containing protein | - |
N2J37_RS12350 (N2J37_12350) | 2569025..2569930 | - | 906 | WP_032716407.1 | LysR family transcriptional regulator | - |
N2J37_RS12355 (N2J37_12355) | 2570033..2570350 | + | 318 | WP_004862785.1 | nuclear transport factor 2 family protein | - |
N2J37_RS12360 (N2J37_12360) | 2570343..2571122 | + | 780 | WP_004862782.1 | SDR family oxidoreductase | - |
N2J37_RS12365 (N2J37_12365) | 2571203..2571676 | - | 474 | WP_015584188.1 | RES domain-containing protein | Toxin |
N2J37_RS12370 (N2J37_12370) | 2571673..2572116 | - | 444 | WP_004862777.1 | DUF2384 domain-containing protein | Antitoxin |
N2J37_RS12375 (N2J37_12375) | 2573912..2574478 | - | 567 | WP_126509581.1 | DJ-1/PfpI family protein | - |
N2J37_RS12380 (N2J37_12380) | 2574892..2575872 | - | 981 | WP_000019450.1 | IS5-like element ISKpn26 family transposase | - |
N2J37_RS12385 (N2J37_12385) | 2575904..2576761 | + | 858 | WP_260990743.1 | type I-F CRISPR-associated endonuclease Cas1f | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2574892..2575872 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17524.82 Da Isoelectric Point: 4.8081
>T257962 WP_015584188.1 NZ_CP104450:c2571676-2571203 [Raoultella ornithinolytica]
MIFYRLVTGRYASEAWTGSGANQYGGRWNHQGHPAVYVSTSIALASLEILVHVKNEAILNQYQLYSIEIPDSEVESLDKQ
WLPDNWQENPMPVSTMDLGTGWLQSGSGLALMLPSCIIPYENNAILNPLHPAFSEALASVRQYPFTFDPRLARSTPL
MIFYRLVTGRYASEAWTGSGANQYGGRWNHQGHPAVYVSTSIALASLEILVHVKNEAILNQYQLYSIEIPDSEVESLDKQ
WLPDNWQENPMPVSTMDLGTGWLQSGSGLALMLPSCIIPYENNAILNPLHPAFSEALASVRQYPFTFDPRLARSTPL
Download Length: 474 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16190.45 Da Isoelectric Point: 4.9405
>AT257962 WP_004862777.1 NZ_CP104450:c2572116-2571673 [Raoultella ornithinolytica]
MKTWVPAEQPADNALWRYAGLPANRGMQLIELLSMGLPVSILDNIHEWTEMSKTDILRITGINERNVARRKSAGGTLTPG
ESERVARFVRVLDTAVDYFGSKQDAYDWLQSPVRGLGNVAPIDLIATESGALEVTDLIGRLEHGVFA
MKTWVPAEQPADNALWRYAGLPANRGMQLIELLSMGLPVSILDNIHEWTEMSKTDILRITGINERNVARRKSAGGTLTPG
ESERVARFVRVLDTAVDYFGSKQDAYDWLQSPVRGLGNVAPIDLIATESGALEVTDLIGRLEHGVFA
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A808Y4A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A808Y7A4 |