Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3962374..3963053 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104448 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01407 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | N5T86_RS21085 | Protein ID | WP_000838146.1 |
| Coordinates | 3962871..3963053 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N5T86_RS21080 | Protein ID | WP_000966688.1 |
| Coordinates | 3962374..3962778 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5T86_RS21060 (N5T86_21065) | 3960653..3960979 | - | 327 | WP_000721696.1 | hypothetical protein | - |
| N5T86_RS21065 (N5T86_21070) | 3961051..3961734 | - | 684 | WP_000720504.1 | hypothetical protein | - |
| N5T86_RS21070 (N5T86_21075) | 3961767..3962090 | - | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N5T86_RS21075 (N5T86_21080) | 3962099..3962275 | - | 177 | WP_075149899.1 | hypothetical protein | - |
| N5T86_RS21080 (N5T86_21085) | 3962374..3962778 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N5T86_RS21085 (N5T86_21090) | 3962871..3963053 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N5T86_RS21090 (N5T86_21095) | 3963379..3963894 | - | 516 | WP_001185602.1 | hypothetical protein | - |
| N5T86_RS21095 (N5T86_21100) | 3963964..3964881 | - | 918 | WP_075149897.1 | phage tail tube protein | - |
| N5T86_RS21100 (N5T86_21105) | 3964978..3966129 | - | 1152 | WP_063558501.1 | hypothetical protein | - |
| N5T86_RS21105 (N5T86_21110) | 3966129..3966482 | - | 354 | WP_063558502.1 | hypothetical protein | - |
| N5T86_RS21110 (N5T86_21115) | 3966551..3966949 | - | 399 | WP_001251844.1 | phage tail terminator-like protein | - |
| N5T86_RS21115 (N5T86_21120) | 3966951..3967319 | - | 369 | WP_063558585.1 | hypothetical protein | - |
| N5T86_RS21120 (N5T86_21125) | 3967291..3967698 | - | 408 | WP_000255076.1 | hypothetical protein | - |
| N5T86_RS21125 (N5T86_21130) | 3967709..3967879 | - | 171 | WP_000220307.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-VIa / sul1 / qacE / blaOXA-2 / aadA5 / ant(2'')-Ia / blaTEM-1B / blaADC-25 / sul2 / blaOXA-65 | pilT / pilU / tufA / pilH / pilG / ompA / plcD / plc / plc / tviB / abaI / abaR / tufA / bfmR / bfmS / htpB / bauF / basA / basB / bauD / bauC / bauE / bauB / bauA / basC / basD / entE / basF / basG / barA / barB / basH / basI / basJ / adeH / adeG / adeF / csuA/B / csuA / csuB / csuC / csuD / csuE / pgaB / pgaC / pgaD / plc | 1..4092895 | 4092895 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T257954 WP_000838146.1 NZ_CP104448:c3963053-3962871 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257954 WP_000966688.1 NZ_CP104448:c3962778-3962374 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|