257954

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3962374..3963053 Replicon plasmid unnamed1
Accession NZ_CP104448
Organism Acinetobacter baumannii strain 2021CK-01407

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag N5T86_RS21085 Protein ID WP_000838146.1
Coordinates 3962871..3963053 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag N5T86_RS21080 Protein ID WP_000966688.1
Coordinates 3962374..3962778 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5T86_RS21060 (N5T86_21065) 3960653..3960979 - 327 WP_000721696.1 hypothetical protein -
N5T86_RS21065 (N5T86_21070) 3961051..3961734 - 684 WP_000720504.1 hypothetical protein -
N5T86_RS21070 (N5T86_21075) 3961767..3962090 - 324 WP_000523928.1 DUF4236 domain-containing protein -
N5T86_RS21075 (N5T86_21080) 3962099..3962275 - 177 WP_075149899.1 hypothetical protein -
N5T86_RS21080 (N5T86_21085) 3962374..3962778 - 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N5T86_RS21085 (N5T86_21090) 3962871..3963053 - 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
N5T86_RS21090 (N5T86_21095) 3963379..3963894 - 516 WP_001185602.1 hypothetical protein -
N5T86_RS21095 (N5T86_21100) 3963964..3964881 - 918 WP_075149897.1 phage tail tube protein -
N5T86_RS21100 (N5T86_21105) 3964978..3966129 - 1152 WP_063558501.1 hypothetical protein -
N5T86_RS21105 (N5T86_21110) 3966129..3966482 - 354 WP_063558502.1 hypothetical protein -
N5T86_RS21110 (N5T86_21115) 3966551..3966949 - 399 WP_001251844.1 phage tail terminator-like protein -
N5T86_RS21115 (N5T86_21120) 3966951..3967319 - 369 WP_063558585.1 hypothetical protein -
N5T86_RS21120 (N5T86_21125) 3967291..3967698 - 408 WP_000255076.1 hypothetical protein -
N5T86_RS21125 (N5T86_21130) 3967709..3967879 - 171 WP_000220307.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-VIa / sul1 / qacE / blaOXA-2 / aadA5 / ant(2'')-Ia / blaTEM-1B / blaADC-25 / sul2 / blaOXA-65 pilT / pilU / tufA / pilH / pilG / ompA / plcD / plc / plc / tviB / abaI / abaR / tufA / bfmR / bfmS / htpB / bauF / basA / basB / bauD / bauC / bauE / bauB / bauA / basC / basD / entE / basF / basG / barA / barB / basH / basI / basJ / adeH / adeG / adeF / csuA/B / csuA / csuB / csuC / csuD / csuE / pgaB / pgaC / pgaD / plc 1..4092895 4092895


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T257954 WP_000838146.1 NZ_CP104448:c3963053-3962871 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT257954 WP_000966688.1 NZ_CP104448:c3962778-3962374 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References