257953

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2386782..2387461 Replicon plasmid unnamed1
Accession NZ_CP104448
Organism Acinetobacter baumannii strain 2021CK-01407

Toxin (Protein)


Gene name hicA Uniprot ID A0A2S4SYJ5
Locus tag N5T86_RS13195 Protein ID WP_002108505.1
Coordinates 2386782..2386964 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag N5T86_RS13200 Protein ID WP_000966688.1
Coordinates 2387057..2387461 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5T86_RS13155 (N5T86_13160) 2381937..2382344 + 408 WP_000255076.1 hypothetical protein -
N5T86_RS13160 (N5T86_13165) 2382316..2382684 + 369 WP_025466445.1 hypothetical protein -
N5T86_RS13165 (N5T86_13170) 2382686..2383084 + 399 WP_025466443.1 phage tail terminator-like protein -
N5T86_RS13170 (N5T86_13175) 2383086..2383304 + 219 WP_001277694.1 hypothetical protein -
N5T86_RS13175 (N5T86_13180) 2383400..2383753 + 354 WP_031975507.1 hypothetical protein -
N5T86_RS13180 (N5T86_13185) 2383753..2384901 + 1149 WP_033841386.1 hypothetical protein -
N5T86_RS13185 (N5T86_13190) 2384954..2385871 + 918 WP_000094249.1 phage tail tube protein -
N5T86_RS13190 (N5T86_13195) 2385941..2386456 + 516 WP_001185610.1 hypothetical protein -
N5T86_RS13195 (N5T86_13200) 2386782..2386964 + 183 WP_002108505.1 type II toxin-antitoxin system HicA family toxin Toxin
N5T86_RS13200 (N5T86_13205) 2387057..2387461 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N5T86_RS13205 (N5T86_13210) 2387560..2387736 + 177 WP_075149899.1 hypothetical protein -
N5T86_RS13210 (N5T86_13215) 2387745..2388068 + 324 WP_000523928.1 DUF4236 domain-containing protein -
N5T86_RS13215 (N5T86_13220) 2388101..2388484 + 384 WP_000725050.1 hypothetical protein -
N5T86_RS13220 (N5T86_13225) 2388546..2389292 + 747 WP_000599536.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-VIa / sul1 / qacE / blaOXA-2 / aadA5 / ant(2'')-Ia / blaTEM-1B / blaADC-25 / sul2 / blaOXA-65 pilT / pilU / tufA / pilH / pilG / ompA / plcD / plc / plc / tviB / abaI / abaR / tufA / bfmR / bfmS / htpB / bauF / basA / basB / bauD / bauC / bauE / bauB / bauA / basC / basD / entE / basF / basG / barA / barB / basH / basI / basJ / adeH / adeG / adeF / csuA/B / csuA / csuB / csuC / csuD / csuE / pgaB / pgaC / pgaD / plc 1..4092895 4092895


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6685.80 Da        Isoelectric Point: 10.5523

>T257953 WP_002108505.1 NZ_CP104448:2386782-2386964 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT257953 WP_000966688.1 NZ_CP104448:2387057-2387461 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4SYJ5

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References