Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2386782..2387461 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104448 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01407 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2S4SYJ5 |
| Locus tag | N5T86_RS13195 | Protein ID | WP_002108505.1 |
| Coordinates | 2386782..2386964 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N5T86_RS13200 | Protein ID | WP_000966688.1 |
| Coordinates | 2387057..2387461 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5T86_RS13155 (N5T86_13160) | 2381937..2382344 | + | 408 | WP_000255076.1 | hypothetical protein | - |
| N5T86_RS13160 (N5T86_13165) | 2382316..2382684 | + | 369 | WP_025466445.1 | hypothetical protein | - |
| N5T86_RS13165 (N5T86_13170) | 2382686..2383084 | + | 399 | WP_025466443.1 | phage tail terminator-like protein | - |
| N5T86_RS13170 (N5T86_13175) | 2383086..2383304 | + | 219 | WP_001277694.1 | hypothetical protein | - |
| N5T86_RS13175 (N5T86_13180) | 2383400..2383753 | + | 354 | WP_031975507.1 | hypothetical protein | - |
| N5T86_RS13180 (N5T86_13185) | 2383753..2384901 | + | 1149 | WP_033841386.1 | hypothetical protein | - |
| N5T86_RS13185 (N5T86_13190) | 2384954..2385871 | + | 918 | WP_000094249.1 | phage tail tube protein | - |
| N5T86_RS13190 (N5T86_13195) | 2385941..2386456 | + | 516 | WP_001185610.1 | hypothetical protein | - |
| N5T86_RS13195 (N5T86_13200) | 2386782..2386964 | + | 183 | WP_002108505.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N5T86_RS13200 (N5T86_13205) | 2387057..2387461 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N5T86_RS13205 (N5T86_13210) | 2387560..2387736 | + | 177 | WP_075149899.1 | hypothetical protein | - |
| N5T86_RS13210 (N5T86_13215) | 2387745..2388068 | + | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N5T86_RS13215 (N5T86_13220) | 2388101..2388484 | + | 384 | WP_000725050.1 | hypothetical protein | - |
| N5T86_RS13220 (N5T86_13225) | 2388546..2389292 | + | 747 | WP_000599536.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-VIa / sul1 / qacE / blaOXA-2 / aadA5 / ant(2'')-Ia / blaTEM-1B / blaADC-25 / sul2 / blaOXA-65 | pilT / pilU / tufA / pilH / pilG / ompA / plcD / plc / plc / tviB / abaI / abaR / tufA / bfmR / bfmS / htpB / bauF / basA / basB / bauD / bauC / bauE / bauB / bauA / basC / basD / entE / basF / basG / barA / barB / basH / basI / basJ / adeH / adeG / adeF / csuA/B / csuA / csuB / csuC / csuD / csuE / pgaB / pgaC / pgaD / plc | 1..4092895 | 4092895 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6685.80 Da Isoelectric Point: 10.5523
>T257953 WP_002108505.1 NZ_CP104448:2386782-2386964 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257953 WP_000966688.1 NZ_CP104448:2387057-2387461 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4SYJ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9L2H6 |