Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 646735..647388 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104448 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01407 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A427QZH0 |
| Locus tag | N5T86_RS04940 | Protein ID | WP_000931891.1 |
| Coordinates | 646735..647124 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | N5T86_RS04945 | Protein ID | WP_001288210.1 |
| Coordinates | 647131..647388 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5T86_RS04925 (N5T86_04930) | 641853..644048 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| N5T86_RS04930 (N5T86_04935) | 644236..644802 | - | 567 | WP_000651536.1 | rhombosortase | - |
| N5T86_RS04935 (N5T86_04940) | 644880..645965 | - | 1086 | WP_000049104.1 | hypothetical protein | - |
| N5T86_RS04940 (N5T86_04945) | 646735..647124 | - | 390 | WP_000931891.1 | hypothetical protein | Toxin |
| N5T86_RS04945 (N5T86_04950) | 647131..647388 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| N5T86_RS04950 (N5T86_04955) | 647576..648748 | + | 1173 | WP_001190558.1 | acyl-CoA dehydrogenase family protein | - |
| N5T86_RS04955 (N5T86_04960) | 648798..650288 | - | 1491 | WP_000415132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| N5T86_RS04960 (N5T86_04965) | 650470..650847 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| N5T86_RS04965 (N5T86_04970) | 650866..651873 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-VIa / sul1 / qacE / blaOXA-2 / aadA5 / ant(2'')-Ia / blaTEM-1B / blaADC-25 / sul2 / blaOXA-65 | pilT / pilU / tufA / pilH / pilG / ompA / plcD / plc / plc / tviB / abaI / abaR / tufA / bfmR / bfmS / htpB / bauF / basA / basB / bauD / bauC / bauE / bauB / bauA / basC / basD / entE / basF / basG / barA / barB / basH / basI / basJ / adeH / adeG / adeF / csuA/B / csuA / csuB / csuC / csuD / csuE / pgaB / pgaC / pgaD / plc | 1..4092895 | 4092895 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15635.91 Da Isoelectric Point: 10.3890
>T257952 WP_000931891.1 NZ_CP104448:c647124-646735 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A427QZH0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |