Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) cptAB/-
Location 646735..647388 Replicon plasmid unnamed1
Accession NZ_CP104448
Organism Acinetobacter baumannii strain 2021CK-01407

Toxin (Protein)


Gene name cptA Uniprot ID A0A427QZH0
Locus tag N5T86_RS04940 Protein ID WP_000931891.1
Coordinates 646735..647124 (-) Length 130 a.a.

Antitoxin (Protein)


Gene name cptB Uniprot ID V5V966
Locus tag N5T86_RS04945 Protein ID WP_001288210.1
Coordinates 647131..647388 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5T86_RS04925 (N5T86_04930) 641853..644048 - 2196 WP_001158905.1 TRAP transporter large permease subunit -
N5T86_RS04930 (N5T86_04935) 644236..644802 - 567 WP_000651536.1 rhombosortase -
N5T86_RS04935 (N5T86_04940) 644880..645965 - 1086 WP_000049104.1 hypothetical protein -
N5T86_RS04940 (N5T86_04945) 646735..647124 - 390 WP_000931891.1 hypothetical protein Toxin
N5T86_RS04945 (N5T86_04950) 647131..647388 - 258 WP_001288210.1 succinate dehydrogenase assembly factor 2 Antitoxin
N5T86_RS04950 (N5T86_04955) 647576..648748 + 1173 WP_001190558.1 acyl-CoA dehydrogenase family protein -
N5T86_RS04955 (N5T86_04960) 648798..650288 - 1491 WP_000415132.1 NAD(P)/FAD-dependent oxidoreductase -
N5T86_RS04960 (N5T86_04965) 650470..650847 - 378 WP_001216380.1 50S ribosomal protein L17 -
N5T86_RS04965 (N5T86_04970) 650866..651873 - 1008 WP_000198631.1 DNA-directed RNA polymerase subunit alpha -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-VIa / sul1 / qacE / blaOXA-2 / aadA5 / ant(2'')-Ia / blaTEM-1B / blaADC-25 / sul2 / blaOXA-65 pilT / pilU / tufA / pilH / pilG / ompA / plcD / plc / plc / tviB / abaI / abaR / tufA / bfmR / bfmS / htpB / bauF / basA / basB / bauD / bauC / bauE / bauB / bauA / basC / basD / entE / basF / basG / barA / barB / basH / basI / basJ / adeH / adeG / adeF / csuA/B / csuA / csuB / csuC / csuD / csuE / pgaB / pgaC / pgaD / plc 1..4092895 4092895


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Flavinator of succinate dehydrogenase

(10-82)


Sequences

Toxin        


Download         Length: 130 a.a.        Molecular weight: 15635.91 Da        Isoelectric Point: 10.3890

>T257952 WP_000931891.1 NZ_CP104448:c647124-646735 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY

Download         Length: 390 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10318.77 Da        Isoelectric Point: 4.6150

>AT257952 WP_001288210.1 NZ_CP104448:c647388-647131 [Acinetobacter baumannii]
MSEEMTLEERKVIYRARRGLKEIDVYFDPYVKNYYLKADPAEKALFAELVEQEDPDLLDWFMEVSEPPRTELRDFIYKLK
HYVHG

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A427QZH0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BQM7

References