Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 274831..275415 Replicon plasmid unnamed2
Accession NZ_CP104447
Organism Acinetobacter baumannii strain 2021CK-01407

Toxin (Protein)


Gene name PumA Uniprot ID N8Q7V3
Locus tag N5T86_RS01175 Protein ID WP_000286964.1
Coordinates 274831..275133 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N5T86_RS01180 Protein ID WP_000985609.1
Coordinates 275134..275415 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5T86_RS01140 (N5T86_01145) 269876..270490 + 615 WP_125281634.1 recombinase family protein -
N5T86_RS01145 (N5T86_01150) 270556..271359 + 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
N5T86_RS01150 (N5T86_01155) 271359..272195 + 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N5T86_RS01155 (N5T86_01160) 272385..272672 + 288 WP_000438825.1 BrnT family toxin -
N5T86_RS01160 (N5T86_01165) 272659..272973 + 315 WP_004728120.1 BrnA antitoxin family protein -
N5T86_RS01165 (N5T86_01170) 273140..273583 - 444 WP_260744098.1 hypothetical protein -
N5T86_RS01170 (N5T86_01175) 273661..274629 + 969 WP_252513945.1 IS30 family transposase -
N5T86_RS01175 (N5T86_01180) 274831..275133 + 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5T86_RS01180 (N5T86_01185) 275134..275415 + 282 WP_000985609.1 putative addiction module antidote protein Antitoxin
N5T86_RS01185 (N5T86_01190) 275495..275914 - 420 WP_001180106.1 SMI1/KNR4 family protein -
N5T86_RS01190 (N5T86_01195) 276054..276374 + 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5T86_RS01195 (N5T86_01200) 276367..276639 + 273 WP_000369781.1 NadS family protein -
N5T86_RS01200 (N5T86_01205) 277132..278607 + 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N5T86_RS01205 (N5T86_01210) 278663..279547 + 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N5T86_RS01210 (N5T86_01215) 279737..280348 - 612 WP_015060246.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaOXA-58 / tet(X3) / sul2 / aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / ARR-3 / qacE / sul1 / blaNDM-1 / aph(3')-VI - 1..335722 335722
- inside IScluster/Tn aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) - 261718..279547 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Uncharacterized protein HI1420

(4-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11573.07 Da        Isoelectric Point: 4.6838

>T257950 WP_000286964.1 NZ_CP104447:274831-275133 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL

Download         Length: 303 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10109.67 Da        Isoelectric Point: 8.0018

>AT257950 WP_000985609.1 NZ_CP104447:275134-275415 [Acinetobacter baumannii]
MAIKLRKWDSAEHLKTEDDMQAYLQACIEESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTV
IKVVKALNLRLAI

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TV94

Antitoxin

Source ID Structure

References