Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4611164..4611883 | Replicon | chromosome |
| Accession | NZ_CP104442 | ||
| Organism | Escherichia coli strain HBUT-L | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | E0J373 |
| Locus tag | N1H43_RS22455 | Protein ID | WP_001095907.1 |
| Coordinates | 4611563..4611883 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E0J374 |
| Locus tag | N1H43_RS22450 | Protein ID | WP_001192122.1 |
| Coordinates | 4611164..4611529 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H43_RS22415 (4606635) | 4606635..4607237 | + | 603 | WP_260579117.1 | hypothetical protein | - |
| N1H43_RS22420 (4607247) | 4607247..4608455 | - | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
| N1H43_RS22425 (4608528) | 4608528..4608776 | + | 249 | WP_260579116.1 | hypothetical protein | - |
| N1H43_RS22430 (4608993) | 4608993..4609469 | + | 477 | WP_001254693.1 | hypothetical protein | - |
| N1H43_RS22435 (4609541) | 4609541..4610362 | + | 822 | WP_000197395.1 | DUF932 domain-containing protein | - |
| N1H43_RS22440 (4610432) | 4610432..4610902 | + | 471 | WP_000104319.1 | DNA repair protein RadC | - |
| N1H43_RS22445 (4610911) | 4610911..4611132 | + | 222 | WP_000691985.1 | DUF987 family protein | - |
| N1H43_RS22450 (4611164) | 4611164..4611529 | + | 366 | WP_001192122.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N1H43_RS22455 (4611563) | 4611563..4611883 | + | 321 | WP_001095907.1 | TA system toxin CbtA family protein | Toxin |
| N1H43_RS22460 (4612092) | 4612092..4612253 | + | 162 | Protein_4384 | virulence RhuM family protein | - |
| N1H43_RS22465 (4612650) | 4612650..4613834 | + | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| N1H43_RS22470 (4613945) | 4613945..4614868 | + | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| N1H43_RS22475 (4614872) | 4614872..4615690 | - | 819 | WP_000779426.1 | lipoprotein NlpA | - |
| N1H43_RS22480 (4615912) | 4615912..4616205 | + | 294 | WP_000805509.1 | protein YicS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12184.76 Da Isoelectric Point: 5.5740
>T257947 WP_001095907.1 NZ_CP104442:4611563-4611883 [Escherichia coli]
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS
MNTPTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVRRAQFNLGLKRS
Download Length: 321 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13470.22 Da Isoelectric Point: 6.8421
>AT257947 WP_001192122.1 NZ_CP104442:4611164-4611529 [Escherichia coli]
MQSTTLSGTSAENVSCLQWGLKRNITPCFGARLVQEGNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR
MQSTTLSGTSAENVSCLQWGLKRNITPCFGARLVQEGNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|