Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2289983..2290509 | Replicon | chromosome |
Accession | NZ_CP104442 | ||
Organism | Escherichia coli strain HBUT-L |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | N1H43_RS11140 | Protein ID | WP_000323025.1 |
Coordinates | 2289983..2290270 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | N1H43_RS11145 | Protein ID | WP_000534858.1 |
Coordinates | 2290270..2290509 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H43_RS11090 (2285007) | 2285007..2285222 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
N1H43_RS11095 (2285442) | 2285442..2285612 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
N1H43_RS11100 (2285976) | 2285976..2286191 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
N1H43_RS11105 (2286492) | 2286492..2286704 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
N1H43_RS11110 (2286759) | 2286759..2286848 | + | 90 | WP_120795389.1 | hypothetical protein | - |
N1H43_RS11115 (2287126) | 2287126..2287878 | - | 753 | WP_001047135.1 | antitermination protein | - |
N1H43_RS11120 (2287892) | 2287892..2288941 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
N1H43_RS11125 (2288943) | 2288943..2289221 | - | 279 | WP_012304870.1 | hypothetical protein | - |
N1H43_RS11130 (2289288) | 2289288..2289539 | - | 252 | WP_000980994.1 | protein Rem | - |
N1H43_RS11135 (2289756) | 2289756..2289911 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
N1H43_RS11140 (2289983) | 2289983..2290270 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
N1H43_RS11145 (2290270) | 2290270..2290509 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
N1H43_RS11150 (2290534) | 2290534..2290839 | + | 306 | WP_001326990.1 | protein YdfV | - |
N1H43_RS11155 (2291042) | 2291042..2291374 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
N1H43_RS11160 (2291811) | 2291811..2291960 | - | 150 | WP_011443592.1 | protein YdfW | - |
N1H43_RS11165 (2292081) | 2292081..2293103 | - | 1023 | Protein_2175 | ISNCY family transposase | - |
N1H43_RS11170 (2293893) | 2293893..2294180 | - | 288 | Protein_2176 | hypothetical protein | - |
N1H43_RS11175 (2294658) | 2294658..2295147 | - | 490 | Protein_2177 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2256013..2309006 | 52993 | |
- | inside | Prophage | - | - | 2257455..2309006 | 51551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T257935 WP_000323025.1 NZ_CP104442:c2290270-2289983 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|