Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2198783..2199421 | Replicon | chromosome |
| Accession | NZ_CP104442 | ||
| Organism | Escherichia coli strain HBUT-L | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | N1H43_RS10670 | Protein ID | WP_000813794.1 |
| Coordinates | 2198783..2198959 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N1H43_RS10675 | Protein ID | WP_001270285.1 |
| Coordinates | 2199005..2199421 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H43_RS10650 (2194402) | 2194402..2195577 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| N1H43_RS10655 (2195669) | 2195669..2196205 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| N1H43_RS10660 (2196278) | 2196278..2198239 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N1H43_RS10665 (2198331) | 2198331..2198561 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| N1H43_RS10670 (2198783) | 2198783..2198959 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N1H43_RS10675 (2199005) | 2199005..2199421 | + | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N1H43_RS10680 (2199500) | 2199500..2200906 | + | 1407 | WP_000760593.1 | PLP-dependent aminotransferase family protein | - |
| N1H43_RS10685 (2201151) | 2201151..2202296 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| N1H43_RS10690 (2202314) | 2202314..2203327 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| N1H43_RS10695 (2203328) | 2203328..2204269 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2193214..2194362 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257933 WP_000813794.1 NZ_CP104442:2198783-2198959 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT257933 WP_001270285.1 NZ_CP104442:2199005-2199421 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|