Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1145855..1146473 | Replicon | chromosome |
Accession | NZ_CP104442 | ||
Organism | Escherichia coli strain HBUT-L |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N1H43_RS05490 | Protein ID | WP_001291435.1 |
Coordinates | 1145855..1146073 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N1H43_RS05495 | Protein ID | WP_000344800.1 |
Coordinates | 1146099..1146473 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1H43_RS05455 (1141144) | 1141144..1141716 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
N1H43_RS05460 (1141747) | 1141747..1142058 | - | 312 | WP_000409911.1 | MGMT family protein | - |
N1H43_RS05470 (1142437) | 1142437..1142790 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N1H43_RS05475 (1142832) | 1142832..1144382 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N1H43_RS05480 (1144546) | 1144546..1145016 | - | 471 | WP_000136192.1 | YlaC family protein | - |
N1H43_RS05485 (1145132) | 1145132..1145683 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N1H43_RS05490 (1145855) | 1145855..1146073 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N1H43_RS05495 (1146099) | 1146099..1146473 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N1H43_RS05500 (1147019) | 1147019..1150168 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N1H43_RS05505 (1150191) | 1150191..1151384 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257929 WP_001291435.1 NZ_CP104442:c1146073-1145855 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257929 WP_000344800.1 NZ_CP104442:c1146473-1146099 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |