Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1111559..1112396 | Replicon | chromosome |
| Accession | NZ_CP104442 | ||
| Organism | Escherichia coli strain HBUT-L | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | N1H43_RS05320 | Protein ID | WP_000227784.1 |
| Coordinates | 1111559..1112101 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | N1H43_RS05325 | Protein ID | WP_001297137.1 |
| Coordinates | 1112085..1112396 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H43_RS05300 (1107109) | 1107109..1108020 | - | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
| N1H43_RS05305 (1108188) | 1108188..1108679 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| N1H43_RS05310 (1108807) | 1108807..1110171 | - | 1365 | WP_001000978.1 | MFS transporter | - |
| N1H43_RS05315 (1110579) | 1110579..1111503 | + | 925 | Protein_1034 | sel1 repeat family protein | - |
| N1H43_RS05320 (1111559) | 1111559..1112101 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| N1H43_RS05325 (1112085) | 1112085..1112396 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| N1H43_RS05330 (1112581) | 1112581..1113471 | - | 891 | WP_000971336.1 | heme o synthase | - |
| N1H43_RS05335 (1113483) | 1113483..1113812 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| N1H43_RS05340 (1113812) | 1113812..1114426 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| N1H43_RS05345 (1114416) | 1114416..1116407 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| N1H43_RS05350 (1116429) | 1116429..1117376 | - | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T257928 WP_000227784.1 NZ_CP104442:c1112101-1111559 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|