Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 529915..530622 | Replicon | chromosome |
| Accession | NZ_CP104442 | ||
| Organism | Escherichia coli strain HBUT-L | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | E0J2C8 |
| Locus tag | N1H43_RS02505 | Protein ID | WP_000691790.1 |
| Coordinates | 530281..530622 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N1H43_RS02500 | Protein ID | WP_000939438.1 |
| Coordinates | 529915..530250 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1H43_RS02475 (525862) | 525862..526080 | - | 219 | WP_001064742.1 | AlpA family phage regulatory protein | - |
| N1H43_RS02480 (526198) | 526198..526812 | - | 615 | WP_000772909.1 | inovirus Gp2 family protein | - |
| N1H43_RS02485 (527405) | 527405..528358 | + | 954 | WP_000290405.1 | hypothetical protein | - |
| N1H43_RS02490 (528594) | 528594..529412 | + | 819 | WP_000761991.1 | DUF932 domain-containing protein | - |
| N1H43_RS02495 (529442) | 529442..529915 | + | 474 | WP_001292742.1 | DNA repair protein RadC | - |
| N1H43_RS02500 (529915) | 529915..530250 | + | 336 | WP_000939438.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N1H43_RS02505 (530281) | 530281..530622 | + | 342 | WP_000691790.1 | TA system toxin CbtA family protein | Toxin |
| N1H43_RS02510 (530737) | 530737..531570 | + | 834 | WP_001192746.1 | DUF4942 domain-containing protein | - |
| N1H43_RS02515 (531640) | 531640..532035 | + | 396 | WP_000152741.1 | DUF6088 family protein | - |
| N1H43_RS02520 (532028) | 532028..532975 | + | 948 | WP_000342500.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| N1H43_RS02525 (533368) | 533368..534633 | + | 1266 | WP_001218329.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 514323..563316 | 48993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13060.08 Da Isoelectric Point: 9.4583
>T257924 WP_000691790.1 NZ_CP104442:530281-530622 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|