Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA(toxin) |
Location | 3564159..3564772 | Replicon | chromosome |
Accession | NZ_CP104408 | ||
Organism | Pseudomonas fluorescens strain Ant01 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A172Z267 |
Locus tag | N4P55_RS16155 | Protein ID | WP_053256594.1 |
Coordinates | 3564159..3564410 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4P55_RS16160 | Protein ID | WP_262665006.1 |
Coordinates | 3564407..3564772 (+) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4P55_RS16155 (N4P55_16170) | 3564159..3564410 | + | 252 | WP_053256594.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N4P55_RS16160 (N4P55_16175) | 3564407..3564772 | + | 366 | WP_262665006.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N4P55_RS16165 (N4P55_16180) | 3564755..3565945 | - | 1191 | WP_221294967.1 | MFS transporter | - |
N4P55_RS16170 (N4P55_16185) | 3566088..3566681 | + | 594 | WP_262665008.1 | TetR/AcrR family transcriptional regulator | - |
N4P55_RS16175 (N4P55_16190) | 3566665..3568020 | - | 1356 | WP_064452749.1 | MATE family efflux transporter | - |
N4P55_RS16180 (N4P55_16195) | 3568046..3568618 | - | 573 | WP_064452750.1 | DUF2239 family protein | - |
N4P55_RS16185 (N4P55_16200) | 3568686..3569642 | - | 957 | WP_221294971.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9485.04 Da Isoelectric Point: 9.6594
>T257922 WP_053256594.1 NZ_CP104408:3564159-3564410 [Pseudomonas fluorescens]
VSKNEKLLAKLLNEHMAFTWPELVTLLHRLGYTQIEGAGSRVKFDIGDPSAMISLHKPHPGNELKHYIRRQIIEQLKSGE
LIQ
VSKNEKLLAKLLNEHMAFTWPELVTLLHRLGYTQIEGAGSRVKFDIGDPSAMISLHKPHPGNELKHYIRRQIIEQLKSGE
LIQ
Download Length: 252 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13283.25 Da Isoelectric Point: 6.9477
>AT257922 WP_262665006.1 NZ_CP104408:3564407-3564772 [Pseudomonas fluorescens]
VNNQLKYKGYIGSIEASLEDNCLFGKILFIKALVSYEGKTVAELEAAFREAVDDYLATCHALGQTPEKPCKGSFNVRVGH
DLHLAAALAATRKKVTLNDLTRQALNEFLQHHCTEPLPVLG
VNNQLKYKGYIGSIEASLEDNCLFGKILFIKALVSYEGKTVAELEAAFREAVDDYLATCHALGQTPEKPCKGSFNVRVGH
DLHLAAALAATRKKVTLNDLTRQALNEFLQHHCTEPLPVLG
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|