Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2046937..2047541 | Replicon | chromosome |
| Accession | NZ_CP104408 | ||
| Organism | Pseudomonas fluorescens strain Ant01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N4P55_RS09535 | Protein ID | WP_262667424.1 |
| Coordinates | 2046937..2047125 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A172YZ10 |
| Locus tag | N4P55_RS09540 | Protein ID | WP_064451580.1 |
| Coordinates | 2047137..2047541 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4P55_RS09505 (N4P55_09520) | 2042132..2043316 | + | 1185 | WP_262667419.1 | c-type cytochrome biogenesis protein CcmI | - |
| N4P55_RS09510 (N4P55_09525) | 2043332..2043727 | + | 396 | WP_262667420.1 | hypothetical protein | - |
| N4P55_RS09515 (N4P55_09530) | 2044161..2044760 | + | 600 | WP_262667421.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
| N4P55_RS09520 (N4P55_09535) | 2044751..2044834 | + | 84 | Protein_1874 | phosphonate metabolism protein PhnP | - |
| N4P55_RS09525 (N4P55_09540) | 2044911..2045606 | - | 696 | WP_262667422.1 | helix-turn-helix transcriptional regulator | - |
| N4P55_RS09530 (N4P55_09545) | 2045681..2046802 | + | 1122 | WP_262667423.1 | cytochrome P450 | - |
| N4P55_RS09535 (N4P55_09550) | 2046937..2047125 | + | 189 | WP_262667424.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4P55_RS09540 (N4P55_09555) | 2047137..2047541 | + | 405 | WP_064451580.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4P55_RS09545 (N4P55_09560) | 2047548..2048744 | - | 1197 | WP_082895853.1 | MFS transporter | - |
| N4P55_RS09550 (N4P55_09565) | 2048923..2049537 | + | 615 | WP_064454889.1 | DUF5666 domain-containing protein | - |
| N4P55_RS09555 (N4P55_09570) | 2049671..2050675 | - | 1005 | WP_262667425.1 | sulfate ABC transporter substrate-binding protein | - |
| N4P55_RS09560 (N4P55_09575) | 2050781..2051605 | - | 825 | WP_064451583.1 | ion transporter | - |
| N4P55_RS09565 (N4P55_09580) | 2051637..2052509 | - | 873 | WP_262667426.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7151.35 Da Isoelectric Point: 12.1548
>T257921 WP_262667424.1 NZ_CP104408:2046937-2047125 [Pseudomonas fluorescens]
VQSRLLIKALQEAGWVLDRVTGSHHIFTHRHSPYTIPVPHPKKDRPLGTVRSIRKRAGLFQF
VQSRLLIKALQEAGWVLDRVTGSHHIFTHRHSPYTIPVPHPKKDRPLGTVRSIRKRAGLFQF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14726.73 Da Isoelectric Point: 4.7437
>AT257921 WP_064451580.1 NZ_CP104408:2047137-2047541 [Pseudomonas fluorescens]
MQYPICIEWGDDFTATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGGVIPMPTSVAHHHAHEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRS
MQYPICIEWGDDFTATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGGVIPMPTSVAHHHAHEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRS
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|