Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1692394..1693009 | Replicon | chromosome |
| Accession | NZ_CP104408 | ||
| Organism | Pseudomonas fluorescens strain Ant01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N4P55_RS07720 | Protein ID | WP_262667269.1 |
| Coordinates | 1692827..1693009 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A172YXH6 |
| Locus tag | N4P55_RS07715 | Protein ID | WP_064451279.1 |
| Coordinates | 1692394..1692804 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4P55_RS07675 (N4P55_07690) | 1687533..1688021 | - | 489 | WP_064451271.1 | DMT family transporter | - |
| N4P55_RS07680 (N4P55_07695) | 1688090..1689016 | + | 927 | WP_262667267.1 | LysR family transcriptional regulator | - |
| N4P55_RS07685 (N4P55_07700) | 1689030..1689440 | + | 411 | WP_064451273.1 | fosfomycin resistance glutathione transferase | - |
| N4P55_RS07690 (N4P55_07705) | 1689495..1690136 | + | 642 | WP_064451274.1 | LysE family translocator | - |
| N4P55_RS07695 (N4P55_07710) | 1690256..1690783 | + | 528 | WP_064451275.1 | DUF4142 domain-containing protein | - |
| N4P55_RS07700 (N4P55_07715) | 1690838..1691263 | - | 426 | WP_064451276.1 | low affinity iron permease family protein | - |
| N4P55_RS07705 (N4P55_07720) | 1691374..1691874 | - | 501 | WP_064451277.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| N4P55_RS07710 (N4P55_07725) | 1691976..1692308 | - | 333 | WP_262667268.1 | hypothetical protein | - |
| N4P55_RS07715 (N4P55_07730) | 1692394..1692804 | - | 411 | WP_064451279.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4P55_RS07720 (N4P55_07735) | 1692827..1693009 | - | 183 | WP_262667269.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4P55_RS07725 (N4P55_07740) | 1693175..1694068 | - | 894 | WP_262667270.1 | LysR family transcriptional regulator | - |
| N4P55_RS07730 (N4P55_07745) | 1694164..1695327 | + | 1164 | WP_262667271.1 | MFS transporter | - |
| N4P55_RS07735 (N4P55_07750) | 1695324..1696460 | + | 1137 | WP_262667272.1 | MFS transporter | - |
| N4P55_RS07740 (N4P55_07755) | 1696707..1696982 | + | 276 | WP_262667977.1 | hypothetical protein | - |
| N4P55_RS07745 (N4P55_07760) | 1697021..1697314 | + | 294 | WP_064451284.1 | helix-turn-helix domain-containing protein | - |
| N4P55_RS07750 (N4P55_07765) | 1697334..1697537 | - | 204 | WP_262667273.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6662.80 Da Isoelectric Point: 10.7532
>T257919 WP_262667269.1 NZ_CP104408:c1693009-1692827 [Pseudomonas fluorescens]
VDSRYLIGHIVADGGYLVRTRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLS
VDSRYLIGHIVADGGYLVRTRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLS
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14712.59 Da Isoelectric Point: 4.2239
>AT257919 WP_064451279.1 NZ_CP104408:c1692804-1692394 [Pseudomonas fluorescens]
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGEDLDDAMAMAREAIEGHFEILAEDGAPIPTAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLNHPEEKSRSGFLASAALKVLQQDG
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGEDLDDAMAMAREAIEGHFEILAEDGAPIPTAQKVTLHAANPQYAGCTWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLNHPEEKSRSGFLASAALKVLQQDG
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|