Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1242151..1242601 | Replicon | chromosome |
Accession | NZ_CP104408 | ||
Organism | Pseudomonas fluorescens strain Ant01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N4P55_RS05425 | Protein ID | WP_262667082.1 |
Coordinates | 1242329..1242601 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A172YWJ3 |
Locus tag | N4P55_RS05420 | Protein ID | WP_064450837.1 |
Coordinates | 1242151..1242339 (+) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4P55_RS05395 (N4P55_05405) | 1237714..1239084 | + | 1371 | WP_262667081.1 | aromatic acid/H+ symport family MFS transporter | - |
N4P55_RS05400 (N4P55_05410) | 1239138..1239941 | - | 804 | WP_221294005.1 | transglutaminase family protein | - |
N4P55_RS05405 (N4P55_05415) | 1240129..1241148 | + | 1020 | WP_064450835.1 | Glu/Leu/Phe/Val dehydrogenase dimerization domain-containing protein | - |
N4P55_RS05410 (N4P55_05420) | 1241204..1241464 | - | 261 | WP_016974596.1 | YebG family protein | - |
N4P55_RS05415 (N4P55_05425) | 1241795..1241998 | + | 204 | Protein_1055 | DUF6124 family protein | - |
N4P55_RS05420 (N4P55_05430) | 1242151..1242339 | + | 189 | WP_064450837.1 | hypothetical protein | Antitoxin |
N4P55_RS05425 (N4P55_05435) | 1242329..1242601 | + | 273 | WP_262667082.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4P55_RS05430 (N4P55_05440) | 1242767..1243255 | + | 489 | WP_064450838.1 | phosphate-starvation-inducible PsiE family protein | - |
N4P55_RS05435 (N4P55_05445) | 1243252..1243569 | - | 318 | WP_064450839.1 | DUF3509 domain-containing protein | - |
N4P55_RS05440 (N4P55_05450) | 1243869..1245155 | - | 1287 | WP_262667083.1 | serine/threonine transporter | - |
N4P55_RS05445 (N4P55_05455) | 1245218..1246594 | - | 1377 | WP_262667084.1 | L-serine ammonia-lyase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10196.86 Da Isoelectric Point: 9.5764
>T257918 WP_262667082.1 NZ_CP104408:1242329-1242601 [Pseudomonas fluorescens]
MLVECAPAARAQLRQITDYISDRNPVAALELNQAIEACVLALSRRPHLYRPGRVVGTREMVVHPNYLVVYQVTDSIRVLS
VLHARQRYPS
MLVECAPAARAQLRQITDYISDRNPVAALELNQAIEACVLALSRRPHLYRPGRVVGTREMVVHPNYLVVYQVTDSIRVLS
VLHARQRYPS
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|