Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
| Location | 75343..76140 | Replicon | plasmid pEH4236 |
| Accession | NZ_CP104406 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain 4236 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | F5S3R9 |
| Locus tag | N5F16_RS23805 | Protein ID | WP_006812498.1 |
| Coordinates | 75343..75867 (-) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | F5S3R8 |
| Locus tag | N5F16_RS23810 | Protein ID | WP_006812497.1 |
| Coordinates | 75871..76140 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5F16_RS23780 (N5F16_23780) | 73014..73802 | + | 789 | WP_032655902.1 | receptor-recognizing protein | - |
| N5F16_RS23785 (N5F16_23785) | 73877..74200 | + | 324 | WP_000064173.1 | hypothetical protein | - |
| N5F16_RS23790 (N5F16_23790) | 74214..74906 | + | 693 | WP_006812500.1 | membrane protein | - |
| N5F16_RS23795 (N5F16_23795) | 74908..75159 | + | 252 | WP_000147960.1 | hypothetical protein | - |
| N5F16_RS23800 (N5F16_23800) | 75152..75316 | + | 165 | WP_006812499.1 | hypothetical protein | - |
| N5F16_RS23805 (N5F16_23805) | 75343..75867 | - | 525 | WP_006812498.1 | GNAT family N-acetyltransferase | Toxin |
| N5F16_RS23810 (N5F16_23810) | 75871..76140 | - | 270 | WP_006812497.1 | DUF1778 domain-containing protein | Antitoxin |
| N5F16_RS23815 (N5F16_23815) | 76529..77194 | + | 666 | WP_023315962.1 | AAA family ATPase | - |
| N5F16_RS23820 (N5F16_23820) | 77200..77553 | + | 354 | WP_160859104.1 | hypothetical protein | - |
| N5F16_RS23825 (N5F16_23825) | 77595..78392 | - | 798 | WP_006812584.1 | DUF2971 domain-containing protein | - |
| N5F16_RS23830 (N5F16_23830) | 78656..79381 | + | 726 | WP_006812583.1 | hypothetical protein | - |
| N5F16_RS23835 (N5F16_23835) | 79442..80782 | + | 1341 | WP_006812582.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..110892 | 110892 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19356.13 Da Isoelectric Point: 8.9844
>T257917 WP_006812498.1 NZ_CP104406:c75867-75343 [Enterobacter hormaechei subsp. steigerwaltii]
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QWY8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QUA3 |