Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3864873..3865530 | Replicon | chromosome |
| Accession | NZ_CP104405 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain 4236 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | N5F16_RS18590 | Protein ID | WP_017382887.1 |
| Coordinates | 3864873..3865283 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | N5F16_RS18595 | Protein ID | WP_003863437.1 |
| Coordinates | 3865264..3865530 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5F16_RS18570 (N5F16_18570) | 3860871..3862604 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5F16_RS18575 (N5F16_18575) | 3862610..3863323 | - | 714 | WP_033487627.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5F16_RS18580 (N5F16_18580) | 3863352..3864248 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| N5F16_RS18585 (N5F16_18585) | 3864350..3864871 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| N5F16_RS18590 (N5F16_18590) | 3864873..3865283 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| N5F16_RS18595 (N5F16_18595) | 3865264..3865530 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| N5F16_RS18600 (N5F16_18600) | 3865825..3866805 | + | 981 | WP_047636517.1 | tRNA-modifying protein YgfZ | - |
| N5F16_RS18605 (N5F16_18605) | 3866917..3867576 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| N5F16_RS18610 (N5F16_18610) | 3867843..3868574 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| N5F16_RS18615 (N5F16_18615) | 3868691..3869152 | + | 462 | Protein_3635 | family 1 glycosylhydrolase | - |
| N5F16_RS18620 (N5F16_18620) | 3869207..3869911 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N5F16_RS18625 (N5F16_18625) | 3869978..3870211 | - | 234 | Protein_3637 | protein-disulfide reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T257915 WP_017382887.1 NZ_CP104405:c3865283-3864873 [Enterobacter hormaechei subsp. steigerwaltii]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |