Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 680719..681295 | Replicon | chromosome |
Accession | NZ_CP104405 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain 4236 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A800YKM1 |
Locus tag | N5F16_RS03345 | Protein ID | WP_015572580.1 |
Coordinates | 680719..681006 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A801DSF4 |
Locus tag | N5F16_RS03350 | Protein ID | WP_017694570.1 |
Coordinates | 680993..681295 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F16_RS03320 (N5F16_03320) | 675812..676531 | + | 720 | WP_050515874.1 | winged helix-turn-helix domain-containing protein | - |
N5F16_RS03325 (N5F16_03325) | 676681..677151 | + | 471 | WP_033486706.1 | MarR family transcriptional regulator | - |
N5F16_RS03330 (N5F16_03330) | 677148..678215 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
N5F16_RS03335 (N5F16_03335) | 678205..679281 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
N5F16_RS03340 (N5F16_03340) | 679278..680549 | - | 1272 | WP_033486707.1 | DUF445 domain-containing protein | - |
N5F16_RS03345 (N5F16_03345) | 680719..681006 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
N5F16_RS03350 (N5F16_03350) | 680993..681295 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
N5F16_RS03355 (N5F16_03355) | 681324..681962 | - | 639 | WP_033486708.1 | LysE family translocator | - |
N5F16_RS03360 (N5F16_03360) | 682001..682753 | - | 753 | WP_033486709.1 | AraC family transcriptional regulator | - |
N5F16_RS03365 (N5F16_03365) | 682907..684277 | + | 1371 | WP_133982341.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
N5F16_RS03370 (N5F16_03370) | 684459..685004 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T257903 WP_015572580.1 NZ_CP104405:680719-681006 [Enterobacter hormaechei subsp. steigerwaltii]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11482.13 Da Isoelectric Point: 10.4094
>AT257903 WP_017694570.1 NZ_CP104405:680993-681295 [Enterobacter hormaechei subsp. steigerwaltii]
MSIVKHKRGSAPEVSARREAELKALADKPDREIDYSDIPATEDDRWAGAVRGKFYRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLRDQNKK
MSIVKHKRGSAPEVSARREAELKALADKPDREIDYSDIPATEDDRWAGAVRGKFYRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLRDQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|