Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 630847..631646 | Replicon | chromosome |
| Accession | NZ_CP104405 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain 4236 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W3D2T8 |
| Locus tag | N5F16_RS03095 | Protein ID | WP_045405101.1 |
| Coordinates | 631269..631646 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N5F16_RS03090 | Protein ID | WP_045405099.1 |
| Coordinates | 630847..631206 (+) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5F16_RS03050 (N5F16_03050) | 626738..627409 | + | 672 | WP_045405089.1 | EcsC family protein | - |
| N5F16_RS03055 (N5F16_03055) | 627406..627657 | + | 252 | WP_023312599.1 | DUF905 family protein | - |
| N5F16_RS03060 (N5F16_03060) | 627773..628591 | + | 819 | WP_045405091.1 | DUF932 domain-containing protein | - |
| N5F16_RS03065 (N5F16_03065) | 628591..628815 | + | 225 | WP_045405093.1 | hypothetical protein | - |
| N5F16_RS03070 (N5F16_03070) | 628940..629419 | + | 480 | WP_080461205.1 | antirestriction protein | - |
| N5F16_RS03075 (N5F16_03075) | 629430..629909 | + | 480 | WP_045405095.1 | DNA repair protein RadC | - |
| N5F16_RS03080 (N5F16_03080) | 629921..630142 | + | 222 | WP_045405097.1 | DUF987 domain-containing protein | - |
| N5F16_RS03085 (N5F16_03085) | 630152..630796 | + | 645 | WP_045405098.1 | hypothetical protein | - |
| N5F16_RS03090 (N5F16_03090) | 630847..631206 | + | 360 | WP_045405099.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5F16_RS03095 (N5F16_03095) | 631269..631646 | + | 378 | WP_045405101.1 | TA system toxin CbtA family protein | Toxin |
| N5F16_RS03100 (N5F16_03100) | 631643..632134 | + | 492 | WP_045405103.1 | DUF5983 family protein | - |
| N5F16_RS03105 (N5F16_03105) | 632164..632367 | + | 204 | WP_023312607.1 | DUF957 domain-containing protein | - |
| N5F16_RS03110 (N5F16_03110) | 632438..633283 | + | 846 | WP_045405106.1 | DUF4942 domain-containing protein | - |
| N5F16_RS03115 (N5F16_03115) | 633427..634224 | + | 798 | WP_047359029.1 | helix-turn-helix transcriptional regulator | - |
| N5F16_RS03120 (N5F16_03120) | 634513..636216 | + | 1704 | WP_047637790.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 605820..646465 | 40645 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.87 Da Isoelectric Point: 6.8696
>T257902 WP_045405101.1 NZ_CP104405:631269-631646 [Enterobacter hormaechei subsp. steigerwaltii]
MQTQSIHPVRATASRPSPVDIWQTLLTYLLEQHYGLTLNDTPFGNDRVIQEHIEAGISLCDGVNFIVEKYELVRIDRHGF
STETQSPLIGSIDILRARKATGLMTRNDYKVVTDITTGKYSGGTR
MQTQSIHPVRATASRPSPVDIWQTLLTYLLEQHYGLTLNDTPFGNDRVIQEHIEAGISLCDGVNFIVEKYELVRIDRHGF
STETQSPLIGSIDILRARKATGLMTRNDYKVVTDITTGKYSGGTR
Download Length: 378 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13267.07 Da Isoelectric Point: 4.5637
>AT257902 WP_045405099.1 NZ_CP104405:630847-631206 [Enterobacter hormaechei subsp. steigerwaltii]
MPDINTTQNDNMDAPSWGLHRDITPCFGARLVQEGNCLHYLADRASITGQFSEADLRHLDQVFPLMLKQLELMLVSGELN
PRHQHCVTLYYNGLICEADTLGSCGYIYLAIYPGEPPAA
MPDINTTQNDNMDAPSWGLHRDITPCFGARLVQEGNCLHYLADRASITGQFSEADLRHLDQVFPLMLKQLELMLVSGELN
PRHQHCVTLYYNGLICEADTLGSCGYIYLAIYPGEPPAA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|